KEGG   Thermococcus pacificus: A3L08_00080Help
Entry
A3L08_00080       CDS       T05192                                 

Definition
(GenBank) type III ribulose-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
tpaf  Thermococcus pacificus
Pathway
tpaf00630  Glyoxylate and dicarboxylate metabolism
tpaf01100  Metabolic pathways
tpaf01120  Microbial metabolism in diverse environments
tpaf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tpaf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    A3L08_00080
Enzymes [BR:tpaf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     A3L08_00080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N LigA
Motif
Other DBs
NCBI-ProteinID: ASJ05841
UniProt: A0A218P4Z0
LinkDB All DBs
Position
complement(10458..11792)
Genome map
AA seq 444 aa AA seqDB search
MVEKFDKIYDYYVDKGYEPNKKRDIIAVFRVTPAEGYTIEQAAGAVAAESSTGTWTTLYP
WYEHERWADMSAKAYHFTDMGDGSWIVRIAYPEHIFEEGNMPGFLASVAGNVFGMKRVEW
LRLEDIYLPERFLRNYPGPNFGIEGVRKKLEIYDRPLYGVVPKPKVGYSPEELYKLALDL
YTGGADYLKDDENLTSPWYNRFEERVKVVTKAMEKAENETGEKKTWFANITSPILEMEQR
LEILADYGVPHAMVDVVVLGWGVLDYIRELAEDYGIALHAHRAMHTAFARYKYHGISMFV
LAKLYRVIGVDQLHIGTAGAGKMEGEKWEVIQYKRIITEDHYVPDENDVYHLEQKFYHIK
PVFPTSSGGLHPGNIQPVIDALGKDIVLQLGGGTMGHPDGPAAGARAVRQAIDAIMQGIP
LDEYAKTHKELARALEKWGHVTPV
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggtggagaagttcgacaagatatacgactactacgtggacaagggctacgagccgaac
aagaagagggacataatagccgttttccgcgttactccggcggagggatacacgatcgag
caggcagccggtgcagtcgctgccgagagctcgaccggaacctggacgaccctttatccc
tggtacgagcatgagagatgggccgacatgtcggcaaaagcttaccacttcacagacatg
ggtgacggtagctggattgtcaggatcgcttacccggagcacatcttcgaggagggcaac
atgcctggctttttagccagcgtcgctggcaacgtcttcggaatgaagcgcgtcgagtgg
ctccgccttgaggatatctaccttccggagaggttcctcaggaactacccgggacccaac
ttcggcattgagggtgtcaggaagaagctcgaaatctatgacaggccgctctacggtgtc
gtccccaagccgaaggtaggttactccccggaagagctctacaagcttgccctcgacctc
tacacaggtggagccgactacctcaaggacgacgagaacctcaccagcccgtggtacaac
cgcttcgaggagcgcgttaaggtcgtcaccaaggccatggaaaaggccgaaaatgagacg
ggagaaaagaagacctggttcgccaacattacctcgccaatactcgagatggagcagagg
cttgagatactcgccgactacggcgttccccacgcgatggttgacgtcgtcgtcctcggc
tggggcgtcctcgactacatccgcgagcttgccgaggactacggcatagctttgcacgcc
cacagggcaatgcacaccgccttcgcccgctacaagtatcacggcatctcgatgttcgtc
ctggccaaactctaccgcgtcatcggcgttgaccagctccacattggtacagccggggcc
ggtaagatggagggcgagaagtgggaggtcatccagtacaagaggataatcaccgaggac
cactacgttccggacgaaaacgatgtctatcaccttgagcagaaattctatcacattaag
cccgtcttcccgaccagctccggcggacttcaccccggcaacatccagcccgtcatagac
gccctcggaaaggacatagtcctccagctcggcggtggaacgatgggacacccggacggg
ccagctgcgggagccagggctgtcaggcaggcaatagacgctatcatgcagggaatcccg
ctcgacgagtacgccaagacccacaaggagctcgccagggccctggagaagtggggccac
gtcaccccggtttga

DBGET integrated database retrieval system