KEGG   Thermococcus pacificus: A3L08_04880Help
Entry
A3L08_04880       CDS       T05192                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
tpaf  Thermococcus pacificus
Pathway
tpaf00500  Starch and sucrose metabolism
tpaf01100  Metabolic pathways
tpaf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tpaf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A3L08_04880
Enzymes [BR:tpaf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     A3L08_04880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3417 RE_LlaJI
Motif
Other DBs
NCBI-ProteinID: ASJ06699
UniProt: A0A218P7E0
LinkDB All DBs
Position
complement(868356..870848)
Genome map
AA seq 830 aa AA seqDB search
MADVSHAVEDSIRAKLPYPLGDLADLAYNYWWSWNRRATKLWEYIDPEHWREYKNPVKLL
LDTPEERFRELLKDDDFMNLYELVMDQFTAYMNPRSTWFSTNYPKWDKPIVYLCMEYGIS
KSLPIYSGGLGILAGDHVKTASDLGLPFIAIGLLYKHGYFRQEIDENGRQREIFPEYRPE
EMPIKPVLGKDGKPLLIEVPIEDRIVYARAFEVNVGRVKLYLLDTDVPENSPEDRTVCDY
LYNAEMDKRIKQEILLGIGGMRLLKALGIEPGVIHLNEGHPAFANLQRIAWYTEKGLTFT
EALSIVRGTTIFTTHTPVPAGHDRFPIEEVRKRLSKFLEGREELLELGREGDQINMTLLA
IRTSSYVNGVSQLHAEVSKRMWKDLWPGVPLNEIPIEGITNGVHTMTWVHNSMRKLFDRY
IGKVWREHTNLEGIWYAVEMIPDEELWEAHLEAKRQFIELLREKIMERNKRLGTDDPIPE
IDENALIIGFARRFATYKRATLILSDLERLKKILNNPERPVYIVFGGKAHPRDEAGKEFL
RRVYEVSQMPEFRGKIFVLENYDMGSARLMVAGVDVWLNNPRRPLEASGTSGMKAGLNGV
LNASIYDGWWVEGYNGKNGWVIGEETTEPETEEDDVKDAESLYTLLEEEIIPTYYDNRER
WIYMMKESIKSIAPRFSTHRMVKEYMDKFYSKAMSNYIWLTRENYRGAKEIAAWKDRVTS
SWDRVEIKEAKVEGSRLDVRVYLDGLKPEDVEVELYYGVRAQGYEIEKPHIVELRHPQEV
GEGEWLYVYEGNALRHLGDPCWHYAVRIHPHHEKLPHRFLLGFVKWRDLI
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgtttcccacgcagttgaggattcaataagggcgaagctcccctatccgctg
ggagatcttgcagatctggcgtataattactggtggagctggaacaggcgtgccaccaag
ctctgggagtacatagatcccgagcactggcgtgaatacaagaacccggtcaaactcctt
ctggacacgccagaagagaggttcagagagctcctcaaggacgacgacttcatgaacctc
tatgagctcgtcatggaccagttcaccgcatacatgaacccgagatcaacatggttctcg
accaactaccccaaatgggacaagccgatagtctatctctgcatggagtacggcataagc
aagagtctcccgatttactccggtggcctcggaatcctcgccggagaccacgtcaagact
gccagtgacctcggccttccgttcatagcgataggcctcctttacaagcacggctacttc
cgccaggaaattgacgagaacgggaggcagagggagatattccccgagtacaggccagaa
gaaatgccaataaaacccgttctgggcaaagacggaaaacctctcctcattgaagttcca
attgaagacaggatagtctacgcgagggccttcgaggtcaacgtcggtagggtcaagctc
tacctcctcgacacggacgtccccgagaacagtccagaggacagaacggtctgcgactac
ctctacaacgccgagatggacaagcgcataaaacaggagatcctccttggaatcggcgga
atgagactgctcaaggctctcggcatcgagcctggtgtaatccacctcaacgagggacat
cccgccttcgccaaccttcagaggatagcatggtacacggaaaaaggtctcaccttcacg
gaagctttgagcatcgtcaggggaacgaccattttcacaacccacacgccggttccggca
ggccacgacagattccctattgaagaggtgagaaagaggctttcaaaattccttgagggg
agagaagagctcctcgaactcggtcgcgagggtgaccagataaacatgaccctcttagcc
ataaggacttcaagctatgtcaacggcgtaagccagctccacgcggaggtaagcaagcgc
atgtggaaggatctctggccaggggttcccctcaacgagatacccatcgagggcataacc
aacggcgtccacacaatgacgtgggtccacaacagtatgaggaagctcttcgaccgttac
atcggcaaggtctggcgtgagcacacaaaccttgagggtatctggtacgctgtggaaatg
attcccgatgaagaactatgggaggcccacctcgaggcaaagaggcagttcatagagctc
ctcagagagaaaataatggagagaaacaagagacttggaactgatgacccaataccggag
atagacgagaacgctctcataataggctttgccaggcgctttgcaacctacaagagggca
acactcatcctgagcgatctcgagaggctgaagaagatacttaacaacccagaaaggcca
gtgtacattgtcttcggtggaaaggcccatccacgcgatgaagctggaaaggagttcctg
agaagggtttacgaggtcagccagatgccagagttcaggggcaagatattcgtcctcgag
aactacgacatgggaagcgcgaggcttatggtagcaggagttgacgtctggctcaacaac
ccacgcagaccgcttgaagccagcggaacaagcggtatgaaggccggccttaacggtgtc
ctcaacgcgagcatctacgatgggtggtgggtcgagggctacaacggcaagaacggctgg
gttatcggggaggaaaccaccgagcctgagaccgaggaagatgacgtgaaggacgctgag
agcctctacaccctactcgaggaggaaataatcccgacctactacgacaaccgcgagcgc
tggatatacatgatgaaggagagcataaagagtatagccccgcgcttcagcacgcacaga
atggtcaaggagtacatggacaagttctactcaaaggccatgagcaactacatatggctc
acgagggagaactacaggggagccaaggaaatagcggcctggaaggacagggttacctcg
tcctgggacagggtggagataaaagaggccaaggttgagggcagcaggcttgatgtcagg
gtttaccttgacggactcaagccagaggacgtcgaggttgaactttactacggcgtcagg
gctcagggctacgaaatagagaagccccacatagtcgagctcaggcatcctcaggaagtt
ggagagggcgagtggctctacgtttacgagggcaacgctctcaggcatcttggcgatccc
tgctggcactacgcggtgagaattcacccgcaccacgagaagctgccccacagattcctg
ctcggctttgtaaaatggagagacttgatctga

DBGET integrated database retrieval system