KEGG   Thermococcus pacificus: A3L08_05295Help
Entry
A3L08_05295       CDS       T05192                                 

Definition
(GenBank) aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tpaf  Thermococcus pacificus
Pathway
tpaf00030  Pentose phosphate pathway
tpaf01100  Metabolic pathways
tpaf01120  Microbial metabolism in diverse environments
tpaf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tpaf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A3L08_05295
Enzymes [BR:tpaf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     A3L08_05295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ASJ06772
UniProt: A0A218P7N1
LinkDB All DBs
Position
complement(939734..941551)
Genome map
AA seq 605 aa AA seqDB search
MYGNWGRFLRVNLSTGEVKVEEYGEELAKKWLGSRGLAIYFLLKEMDPKVDPLSPENKLI
ITPGPLSGTSAPTGGRYNVVTKSPLTGFITMANSGGYFGAELKFAGWDGIIVEGKAEKPV
YIYINDDNVEIRDASHLWGKVVSETEEAIRKEIGSKKVRIALIGPAGENLVKFAAIMNDG
HRAAGRAGVGAVMGSKNLKAIAVEGSKRVPIADKQKFMLTVREKINKIKNDPVAGGGLPK
YGTAVLVNIINENGLYPTRNFQKGVFEHAYEQSGEAMTAKYLIRNQPCYACPIGCGRVNK
LPTVGVTEGPEYESTWTFGANLGINDLASIIEANHQCDEFGLDTISTGGTLATAMELYEK
GHITDEELGDAPPFRWGNTEVLHYYIEKIAYRKGFGDKLAEGGYRLAESYGHPEYSMSVK
KLELPAYDPRGAEGHGLGYATNNRGGCHIKNYMISPEILGYPYKMDPHDISDEKVKMLII
FQDLTALIDAAGLCVFTTFGLGADDYRDMLNAALGWDFSTEDYLKIGERIWNAERIFNLK
AGLVPERDDNLPKRFLEEPMPEGPNKGHVVRLKEMLPRYYALRGWTEDGRVPKEKAEELG
IAEFL
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtacggcaactggggtagatttctgcgtgtaaacctctccacgggggaggtaaaggtt
gaggagtatggcgaagaactcgccaagaagtggctcggaagcaggggcctggccatatac
ttcctcctaaaggagatggacccaaaggtcgaccctctcagccctgagaacaaactgatc
attacaccgggcccgctgagcggtacgagcgctccaactggtggaagatacaacgtcgtc
acgaagagcccgctgacgggctttataaccatggcaaactcgggtggctactttggtgcc
gagttgaagtttgccggctgggacggcataatcgttgagggcaaggccgaaaagccggtg
tacatctacataaacgacgataacgttgagatccgcgatgcgagtcacctctggggcaag
gtcgtgagcgagacagaagaggccatcagaaaggagatagggagcaagaaggtgaggata
gcactgatcgggccggcaggtgagaacctcgttaagtttgccgccattatgaacgacggc
cacagggcagctggaagggccggagttggagcagtcatgggcagcaagaacctcaaggca
atagccgttgagggaagcaagcgcgtcccgatagcggacaagcagaagttcatgctcacc
gtcagggagaagataaacaagatcaagaacgaccctgtcgccggcggtggacttccaaag
tacggtacagcagttctggtcaacataatcaatgagaacggtctctatccaacgaggaac
ttccagaagggcgtctttgagcacgcctacgagcagagtggtgaggcgatgactgccaag
tacctcataaggaaccagccgtgctacgcctgtccgataggctgtggaagggtcaacaag
ctcccgaccgttggagtaactgaggggccagagtacgagagcacctggacctttggagcc
aacctaggcataaacgatttagccagcataatcgaggccaaccaccagtgcgacgagttc
ggtctcgacaccatctcgaccggtggaacgctcgccacagccatggagctctacgagaag
ggccacataacggacgaggagctcggcgatgcgccgccgttcaggtgggggaacacggag
gttctgcactactacatagagaagatagcctacaggaagggctttggtgacaagctcgcg
gagggtggctaccgcctcgccgagagctacggccacccggagtactccatgagcgtcaag
aagcttgagcttccggcatatgaccctcgtggagccgagggacacggcctcggttacgca
accaacaaccgcggcggttgccacatcaagaactacatgataagcccagagattctgggg
tatccctataagatggacccgcacgacataagcgatgagaaggtgaagatgctcataatc
ttccaggatttgacggccctcatcgacgccgctggactgtgtgtcttcacgaccttcggc
cttggagcggacgactaccgtgacatgctgaatgccgcgttaggctgggacttctcaacc
gaggactacctcaagattggagagcgcatctggaacgccgagaggattttcaacctcaag
gccggactcgttccggagagggacgacaacctgccgaagcgcttcttggaagagccgatg
cccgaggggccgaacaagggccacgttgtccgcctgaaggagatgctcccgcgctactac
gctctccgcggctggaccgaggacggaagggttccgaaggagaaagcggaagagctcggc
atagcggagttcctctga

DBGET integrated database retrieval system