KEGG   Thermus parvatiensis: AV541_07520Help
Entry
AV541_07520       CDS       T04274                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
tpar  Thermus parvatiensis
Pathway
tpar00620  Pyruvate metabolism
tpar00680  Methane metabolism
tpar00710  Carbon fixation in photosynthetic organisms
tpar01100  Metabolic pathways
tpar01120  Microbial metabolism in diverse environments
tpar01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tpar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AV541_07520
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AV541_07520
   00680 Methane metabolism
    AV541_07520
Enzymes [BR:tpar01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AV541_07520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF4350
Motif
Other DBs
NCBI-ProteinID: AMA75869
UniProt: A0A0X8D8P0
LinkDB All DBs
Position
complement(1371548..1374124)
Genome map
AA seq 858 aa AA seqDB search
MSQDPFALLKAEVDLLGRLLGEAIWTLSGERFFALVEEVRALAKARRQGDEAAGEALLAR
VEGLSTEEAEALVRAFTHYFHLVNLAEERHRVRVNRLRAQAETLESPRPEGFLALAKALK
ERGLSLEEAEAHLNRLELLLTFTAHPTETRRRTLRHHLEALQRELEAGDRERLAARVALL
YGTEEVRKARPTVEDEIKGGLYYLPTTLWEAVPRVVAGLEAALERVYGRRPRLKSPVRFR
SWIGGDRDGNPFVTPEVTAFAGRYAREVARRRFLEALEDLVRDLSLAETRVPVPREVRER
GEGVERFPGEPYRRYFAALYRALEREEATTEGLLAALKAAERGLREVGLGRVVEAFLDPL
EARLSAFGLELAPLDLREESGRLLEAAAELLRVGGVHPDFLALPQEERERLLTEELKTAR
PLLPVGEAPEGEALRVALGALKAWRDKGAHVVSMTHHPEDLLAVFLLAREVGLYRPGQPL
PFDVVPLFETLEDLRRAPGVLRRLLENPVFLAHARGRGGVEMMIGYSDSNKDAGFLMANL
ALYEAQEALSRVGEEVGLPVYFFHGRGTSTARGGGPAGRAIASLPPRSVGRRIRLTEQGE
ALADRYSHPDLAVRHLEQMLYHFALAALGPGQEPEARWREALAQAAEESTRRYRALLQEE
GFFDFFEAFTPIREIGELPIASRPVYRRGRVRDIRDLRAIPWVMAWTQVRVLLPGWYGLS
ALEELPLDLLREMYRGWPFFASTLEAAAMALAKADMGVARLYLRLVPEPLRFFYRRLAEE
HARTVALLEAVFQAPLLHNQRTLERQIRLRNPYVDPINIVQVELLRRYRAPGGKEDEALR
RALLLSILGVAAGLRNAG
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
gtgagccaggaccccttcgccctcctcaaggccgaggtggacctcctcggccgcctcctc
ggggaggccatctggaccctctccggggagcgcttcttcgccctggtggaggaggtgcgg
gccctcgccaaggcccgccgccagggggacgaggcggcgggggaggcgcttttggcccgg
gtggaggggctttccaccgaggaggccgaggccttggtgcgggccttcacccactacttc
cacctggtgaacctggcggaggagcggcaccgggtgcgggtgaaccgcctaagggcccag
gccgagaccctggaaagccccaggcccgagggtttcctggccctggccaaggcgcttaag
gagcgggggctttccctggaggaggccgaggcccacctgaaccgcctggagctcctcctc
accttcaccgcccaccccacggagacccggcgccgcaccctgcgccaccatctggaggcc
ctgcagagggagctggaggcgggggatagggaaaggctcgccgcccgggtggccctcctc
tacggcacggaggaggtgcgcaaggcccgccccacggtggaggacgagatcaaggggggg
ctttactacctgcccaccaccctgtgggaggccgtgccccgggtggtggcgggcctcgag
gccgccctggagagggtctacgggcgaaggccccgcctgaaaagccccgtgcgctttagg
agctggatcggcggcgaccgggacggcaaccccttcgtcacccccgaggtcaccgccttc
gccgggcgctacgcccgggaggtggcccggaggcggtttttggaggccctcgaggacctc
gtgcgcgacctctctttggccgagacccgcgtccccgtcccccgggaggtgcgggagagg
ggagagggggtggagcgctttcccggggagccctaccgccgctacttcgccgccctgtac
cgggccttagagcgggaggaggccaccacggaagggcttcttgccgccctgaaggcggcg
gagcgggggcttagggaggtggggcttggccgggtggtggaggccttcttggatcccttg
gaggcccgcctttccgccttcggcctggagcttgcccccctggacctcagggaggagtcg
gggaggcttcttgaggctgcggccgagctcctccgggtgggcggggtccaccccgacttc
ctcgcccttccccaggaggagcgggagcgcctcctcaccgaggagctcaagaccgcccgc
cccctcctccccgtgggggaggccccggagggggaggccctaagggtggccctgggggcc
ctgaaggcctggcgggacaagggggcccacgtggtctccatgacccatcacccggaggac
ctcctcgccgtcttcctcctcgcccgggaggtggggctctaccgtcccggccagccccta
ccctttgacgtggttcccctctttgagaccctggaggacctgaggcgggcccccggggtg
ctccgccgccttttggagaaccccgtcttcctggcccacgcccgggggcggggcggggtg
gagatgatgatcggatactccgactccaacaaggacgcgggcttcctcatggccaacctc
gccctttacgaggcccaggaggccttaagccgggtgggggaggaggtggggcttcccgtc
tacttcttccacggtcgggggacctccacggcgaggggcgggggccccgcgggccgggcc
atcgcgagcctcccgccccggagcgtggggcggaggatccgcctcacggagcagggggag
gccctggcggaccggtacagccaccccgacctcgccgtgcgccacctggagcagatgctg
taccacttcgccctggcggccctgggccccggccaggagcccgaggcgcgctggcgggag
gccctggcccaggcggcggaggagagcacccgccgctaccgcgccctcctccaggaggag
gggttctttgacttctttgaggccttcacccccatccgggagatcggggagcttcccatc
gccagccgccccgtgtaccgccgggggcgggtgcgggacatccgggacctccgggccatc
ccttgggtcatggcctggacccaggtccgggttctcctgcccggctggtacggcctctct
gctctggaagagcttcctttggaccttctccgggagatgtaccggggctggcccttcttc
gcctccaccctggaggccgcggccatggccctcgccaaggcggatatgggggtggcccgc
ctctatctgcgcctggtccccgagcccctgaggttcttctaccgccggctcgccgaggaa
cacgcccgcaccgtggcccttttggaggccgtcttccaggcccccctcctccacaaccag
aggaccctggagcggcagatccggctccgcaacccctacgtggaccccatcaacatcgtc
caagtagagctgctccgccgttaccgggccccgggaggcaaggaggacgaggccttgagg
cgggcccttctcctctccattctgggcgtggcggcgggcctcaggaacgcgggttga

DBGET integrated database retrieval system