KEGG   Thermus parvatiensis: AV541_10010Help
Entry
AV541_10010       CDS       T04274                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tpar  Thermus parvatiensis
Pathway
tpar00010  Glycolysis / Gluconeogenesis
tpar00020  Citrate cycle (TCA cycle)
tpar00620  Pyruvate metabolism
tpar01100  Metabolic pathways
tpar01110  Biosynthesis of secondary metabolites
tpar01120  Microbial metabolism in diverse environments
tpar01130  Biosynthesis of antibiotics
tpar01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tpar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AV541_10010
   00020 Citrate cycle (TCA cycle)
    AV541_10010
   00620 Pyruvate metabolism
    AV541_10010
Enzymes [BR:tpar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AV541_10010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 HlyD_D23 NQRA HupF_HypC GCV_H
Motif
Other DBs
NCBI-ProteinID: AMA76195
UniProt: H7GDW1
LinkDB All DBs
Position
complement(1833908..1835179)
Genome map
AA seq 423 aa AA seqDB search
MEVKLPELGDNVTQATVVGVLVKEGDRVEPGQPLLELETDKAVVEVPAEAGGVVQKVLVK
VGDEVRPGQPILVLAGEAEAKAEEKPEPPAPKAEEKPEPAPKAQEEPPPAPKEAPPAPKE
VPAEGRLIPAAPSIRRLARELGVDLAQVRGTGLAGRITEEDVRRAAGLAEAPAGPLPAPA
PRLPDFSKWGPVRTEPMSGVRKATARAMAQAWSQVPMVTHFDEADVTELEALRKQYAKKA
EEKGFRLTLTAFLLKALALTLKAFPKFNASLDPEKGEVIYKDYIHIGVAVDTPHGLLVPV
IRHVDQKGVLRLAEELQEISEKARERKLAPEEMQGGTFSLSNLGGIGGVGFTPIVNWPEV
AILGVSRSQMKPLWDPGKEAFVPRLVMPFSLTYDHRLIDGADAARFCRHLAGILEDPLGL
ALA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgaagctacctgaactcggcgacaacgtgacccaggccaccgtggtgggcgtt
ttggtgaaggagggggaccgggtggagccgggccagccccttctggagctggagacggac
aaggcggtggtggaggtgcccgcagaggcgggcggggtggtgcagaaggtcctggtcaag
gtgggggacgaggtgcgcccgggccagcccatcttggtgctggccggggaggcggaagct
aaggcggaggagaagccggagccgcctgcccccaaggccgaggagaagcccgaaccagcc
cccaaggcccaggaagaaccccctcccgctcccaaggaagcccctcctgcgcccaaggag
gtccccgccgagggccgcctcatcccggcggctccctccataaggcggctcgcccgggag
cttggggtggacctcgcgcaggtccggggcacgggacttgccgggcggattaccgaggag
gacgtgcgccgggcggcgggcctcgccgaggccccggcaggcccccttccggcccccgcc
cccaggcttcccgacttcagcaagtggggcccggtgcgcaccgagcccatgagcggggtg
cgcaaggccacggcgcgggccatggcccaggcctggagccaggtgcccatggtcacccac
tttgacgaggcggacgtcaccgagctggaggctttgcgcaagcagtacgccaagaaggcc
gaggagaaggggttccgcctcaccctcaccgccttcctcctcaaggccctggccctcacc
ctgaaggccttccccaagttcaacgcctcccttgaccccgagaaaggggaggtcatctac
aaggactacatccatatcggggtggcggtggacacgccccatggcctcctcgtcccggtg
atccgccacgtggaccagaagggggttttgcgcctggccgaggagctccaggagatctcc
gagaaggcccgggaaaggaagcttgcccccgaggagatgcaggggggcaccttcagcctc
tccaacctgggggggattgggggagtgggcttcacccccatcgtcaactggccggaggtg
gccatcctcggggtctcccgctcccagatgaaacccctttgggaccccgggaaggaggcc
ttcgtgccccggctcgtgatgcccttcagcctcacctacgaccaccgcctcattgacggg
gccgacgccgcccgcttctgccgccaccttgcggggattctggaggaccccctgggcctc
gccctagcctag

DBGET integrated database retrieval system