KEGG   Thermofilum pendens: Tpen_1227Help
Entry
Tpen_1227         CDS       T00446                                 

Definition
(GenBank) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
tpe  Thermofilum pendens
Pathway
tpe00630  Glyoxylate and dicarboxylate metabolism
tpe01100  Metabolic pathways
tpe01120  Microbial metabolism in diverse environments
tpe01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tpe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Tpen_1227
Enzymes [BR:tpe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Tpen_1227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N 4HFCP_synth Glyco_trans_4_3 FA_desaturase_2
Motif
Other DBs
NCBI-ProteinID: ABL78625
UniProt: A1RZJ5
LinkDB All DBs
Position
1164846..1166177
Genome map
AA seq 443 aa AA seqDB search
MPEEFEPYGEFVVKSYLPDPDKDVIVTFRVTPSEGFTIEDAAGGVAAESSVGTWTTLYQW
YDKSRIDRLKGKAYYMESLGDGSYILRVAYPVELFEEGNMPAFLASVAGNIFGMRRVRSL
RVEDIYLPEAFLKHFKGPSQGVEGVRGKLKIWGRPIIGTVPKPKVGYSPEEVEKLAYEIL
VGGMDFVKDDENLAGPSYCRFEERAKAIMKAIDRAEKETGERKAWLANITADVREMERRL
KLVAELGNTHVMVDVVIAGWSSLTYVRDLAADYKLAIHGHRAFHAAFTRNPYHGVSMFTL
AKLYRIIGVDQLHVGTPEVGKLEAKAVDVIRMARLLREQTYKPDIEDGLHMQQPFPGIKP
AFPVSSGGLHPGTLPAVIKAMGVDTVIQVGGGVVGHPDGPRAGAAAARQAVEAYLEGVPL
QEYAKTHRELARALEKWGQVIPV
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgccggaagagtttgaaccttacggcgaatttgtggtcaagagctacctgccggatccc
gataaagacgtcattgtcacatttagggttactccgagcgagggcttcacaatagaggac
gcagcgggaggcgtagccgcggagagcagcgtcggcacgtggactaccctgtaccagtgg
tacgataagagcaggatcgacaggctcaaggggaaggcttactacatggagagcctgggc
gacgggtcatacatcctccgggtcgcgtaccccgtcgagctgttcgaagaggggaacatg
ccggccttcctggcgtccgttgccggcaacattttcggcatgaggagggtccgctccctg
agggttgaggacatatacttgcccgaagccttcctgaagcacttcaagggcccctcgcag
ggcgtcgagggtgtacgcgggaagctgaagatctgggggaggcccataataggcaccgtg
ccgaagccgaaggtcgggtactcccccgaggaggtcgagaagctggcctacgagatactg
gtcgggggcatggacttcgtgaaggacgacgagaacctggcgggcccgagctactgcagg
ttcgaggagagggctaaggcgataatgaaggcgatagacagggccgaaaaggagacgggc
gagaggaaggcctggctcgccaacataacggcggacgtcagggagatggagcgcaggctt
aagcttgtagcggagctcggcaacacgcacgtcatggtcgacgtggtgatagcgggctgg
tcctccctgacgtacgtaagggatctagccgcggactacaagctggcgatacacgggcac
agggctttccacgccgccttcacccggaacccctaccacggtgtatcgatgttcaccctc
gcgaagctgtacaggataatcggcgtcgaccagctacacgtagggacaccggaggtcggc
aagctggaggcgaaagccgtagacgtgatcaggatggcgcgcctactcagggagcagacg
tacaagccagacattgaggacgggctccacatgcagcaaccattccccgggataaagccg
gctttccccgtctccagcggaggcctccacccgggcacgctacccgctgtcatcaaggct
atgggcgtagacaccgtcatccaggttggagggggcgttgtagggcaccccgacggaccg
agggcgggcgccgccgcggctaggcaggctgtagaagcgtacctcgagggagtcccgcta
caggagtacgcgaagacgcacagagagcttgcaagagccctcgagaaatgggggcaagtg
atacccgtctag

DBGET integrated database retrieval system