KEGG   Thermofilum pendens: Tpen_1333Help
Entry
Tpen_1333         CDS       T00446                                 

Definition
(GenBank) ABC transporter related
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
tpe  Thermofilum pendens
Brite
KEGG Orthology (KO) [BR:tpe00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tpe02000]
    Tpen_1333
Transporters [BR:tpe02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter
    Tpen_1333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_23 AAA_29 ATPase_2 AAA_22 AAA_16 SMC_N DLIC CLP1_P T2SSE RecA AAA_24 AAA_13 MobB
Motif
Other DBs
NCBI-ProteinID: ABL78730
UniProt: A1RZV0
LinkDB All DBs
Position
complement(1286524..1287471)
Genome map
AA seq 315 aa AA seqDB search
MELAVETDRLVKVYRDRGSEVKALDEVSLRVPAGSIFGIFGPNGSGKTTLISILLGLILP
TRGSARVLGYDVVKQSLSVRKRVGLLPEAFGLYEHMTALDNLVFFGLLDEVPKGEVEKRA
REVLELVGLSNKAGAKVSTFSRGMIQRLGLAQVLMKDPDLVILDEPTMGLDPDGIELLKI
LVLGLRERGKTIMISTHLLHEVGNICTHAAIIRKGKVLAQGSLEEVTRELAEKQYSAYAV
RRTDYSERLLEELRSLPEVIVTGHGGNTIRVLAKNDRVSALIEVAEKHGAAVEPLTYREV
TWEDVYRFYQGGARW
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
gtggagctcgccgtggaaacagataggctggtcaaagtttatagggacaggggatccgag
gtcaaggctctcgacgaggttagcctcagagtgccggctggaagcatcttcggcatattc
gggcccaacggttccgggaagaccacgcttatatcaatcctcttgggcttgattttaccc
acgaggggtagcgcaagggtgctggggtacgacgttgtaaagcagtccctaagcgtgaga
aagagggtggggttgctacccgaggccttcggcttgtacgagcacatgaccgcgcttgat
aacctagtatttttcgggctactagacgaggtgccgaaaggcgaggtcgagaaaagggcc
cgcgaggtcctcgagctcgtaggactgagcaataaggcgggcgcaaaggtctccactttc
tcgaggggcatgatacagaggctggggctagcgcaggttctcatgaaagacccagacctc
gtaatcctcgacgagccgacgatgggcctcgatccagacggcatagaactcctaaagatc
ctagtgctagggctcagggagaggggcaagaccataatgatatccacgcacctcctccac
gaagtcggcaacatctgcacgcatgcagcgataatcaggaagggtaaggtattagctcag
ggtagcctcgaggaagttacacgagaactcgcagaaaagcagtattcagcctacgcggtg
agaaggacggattactccgagaggctcctcgaggagctccgctcgctccccgaagtcata
gttacggggcacggcgggaacacgatcagggttttagcgaagaacgaccgcgtctccgcg
ctcatcgaggtcgctgaaaagcacggagccgccgtagaacccttaacatacagggaggta
acctgggaagacgtgtaccgcttctaccagggtggtgctaggtggtaa

DBGET integrated database retrieval system