KEGG   Thermococcus peptonophilus: A0127_03280Help
Entry
A0127_03280       CDS       T04728                                 

Definition
(GenBank) sarcosine oxidase subunit beta
  KO
K00303  sarcosine oxidase, subunit beta [EC:1.5.3.1]
Organism
tpep  Thermococcus peptonophilus
Pathway
tpep00260  Glycine, serine and threonine metabolism
tpep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpep00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A0127_03280
Enzymes [BR:tpep01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.1  sarcosine oxidase
     A0127_03280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO NAD_binding_8 FAD_binding_2 Pyr_redox Pyr_redox_2 Thi4 FAD_binding_3 Pyr_redox_3 ApbA NAD_binding_7 TrkA_N 3HCDH_N HI0933_like AlaDh_PNT_C UDPG_MGDP_dh_N F420_oxidored GIDA FAD_oxidored Trp_halogenase NAD_Gly3P_dh_N DUF1188 NAD_binding_9 Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AMQ18259
UniProt: A0A142CU07
LinkDB All DBs
Position
625720..626880
Genome map
AA seq 386 aa AA seqDB search
MPTRELPKKSEITIIGGGIVGVTIAHELAKRGEEVTVIEKRFIGSGSTFRCGTGIRQQFN
DEANVQVMKRSVELWKKYSEEYGFPFQQTGYLFLLYDDDEVETFKRNIAIQNKFGVPTRL
ITPEEAKEIVPLLDISEVVAASWNPTDGKASPFHSTAKFALHAEEFGAKLVEYTEVKDFI
IENGEIKGLKTSRGTIKTGIVVNATNAWAKLTNAMAGIRTKIPIEPYKHQAVITQPIKKG
SVKPMVISFRYGHAYLTQTAHGGIIGGVGYEEGPTYDLNPTYEFLREVSYYFTKIIPALR
ELLILRTWAGYYAKTPDSNPAIGKIEELSDYYIAAGFSGHGFMMAPAVAEMVADLITKGR
TDLPAWWYDPYRFERGELRGKALQMG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgccgacgagggagcttcccaagaagagtgagataacgataataggcggtggaatagtc
ggcgtcaccatcgcccacgaattagccaagcgcggtgaggaagttacggtgatagagaag
cgcttcatcggttcaggctccaccttccgctgtggaacggggataaggcagcagttcaac
gacgaagcgaacgtccaagtcatgaagcgctccgtcgagctctggaagaagtacagcgaa
gaatacggcttcccgttccagcagacgggctacctcttcctcctctacgacgacgatgaa
gtcgagaccttcaagaggaacatagcgatacagaacaagttcggcgtcccaacaaggctc
ataactcctgaggaagcgaaggagatagttcctctcctcgacataagcgaggttgtcgcc
gcttcctggaacccgaccgacggaaaggccagcccgttccactcgacggcgaagttcgcc
ctccacgccgaagagttcggggcaaagctcgttgaatacaccgaggtcaaggacttcata
atcgagaacggtgagataaaagggctaaagacgagcagggggacgataaagacgggaata
gtggtcaatgccaccaacgcctgggccaagctcaccaacgcgatggcgggtataaggacg
aagatacccatagaaccctacaagcaccaggcggttataacccagcccataaagaagggc
tctgttaagccgatggtcatctcgttcaggtacggacatgcttacctcacccagacggca
cacggcgggataataggcggtgtcggctacgaggaaggcccgacctacgacctcaacccg
acctacgagttcctccgcgaggtgagctactacttcaccaagataattcccgccctaagg
gaactcctcatcctgaggacttgggccggttattacgccaagacacccgacagcaacccg
gcgataggcaaaatcgaggagctgagcgactactacatagcggctggcttcagtgggcac
ggattcatgatggctccggctgtggcggagatggtagctgatctcattacaaagggcagg
acagatttgccggcctggtggtacgacccgtaccgcttcgagaggggagagctaaggggc
aaggccctgcagatgggctga

DBGET integrated database retrieval system