KEGG   Thermococcus peptonophilus: A0127_05020Help
Entry
A0127_05020       CDS       T04728                                 

Gene name
porA
Definition
(GenBank) pyruvate ferredoxin oxidoreductase
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
tpep  Thermococcus peptonophilus
Pathway
tpep00010  Glycolysis / Gluconeogenesis
tpep00020  Citrate cycle (TCA cycle)
tpep00620  Pyruvate metabolism
tpep00640  Propanoate metabolism
tpep00650  Butanoate metabolism
tpep00680  Methane metabolism
tpep00720  Carbon fixation pathways in prokaryotes
tpep01100  Metabolic pathways
tpep01110  Biosynthesis of secondary metabolites
tpep01120  Microbial metabolism in diverse environments
tpep01130  Biosynthesis of antibiotics
tpep01200  Carbon metabolism
Module
tpep_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tpep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A0127_05020 (porA)
   00020 Citrate cycle (TCA cycle)
    A0127_05020 (porA)
   00620 Pyruvate metabolism
    A0127_05020 (porA)
   00640 Propanoate metabolism
    A0127_05020 (porA)
   00650 Butanoate metabolism
    A0127_05020 (porA)
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    A0127_05020 (porA)
   00680 Methane metabolism
    A0127_05020 (porA)
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    A0127_05020 (porA)
Enzymes [BR:tpep01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     A0127_05020 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C
Motif
Other DBs
NCBI-ProteinID: AMQ18570
UniProt: A0A142CUW8
LinkDB All DBs
Position
929369..930553
Genome map
AA seq 394 aa AA seqDB search
MPIRTVMKANEAAAWAAKLAKPKVIAAFPITPSTLVPEKISEFVANGELDAEFIKVESEH
SAISACVGASAAGVRTFTATASQGLALMHEVLFIAAGMRLPIVIAVGNRSLSAPINIWND
WQDSISERDTGWLQFYAENNQEALDLILIAFKVAEDERVLLPAMVGFDAFILTHTVEPVE
IPDQEVVDEFLGEYEPKHAYLDPARPITQGTLAFPAHYMEARYTVWEANENAKKVIDEAF
TEFEKKFGRKYQKVEEYRTDDADIIFVTMGSLAGTVKEYVDHLREKGLKVGAAKLTVYRP
FPTEEVRELAKKAKVLALLEKNVTFSVGGALFQDFSRALVNLDERPKIVDFILGLGGRDV
TFKNLDEALAIAQKALNGEEFDEVNWVGLRKEIL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgccgataaggaccgttatgaaagctaacgaagccgccgcctgggcggccaagctggcc
aagcccaaggttatcgcggccttcccgattacaccgtcgaccctcgttccggagaagatt
agtgagtttgtagccaacggagagctcgatgccgagttcatcaaggtcgagagcgagcac
tccgctatctccgcctgtgtcggtgcttcggcagcaggcgttaggactttcacagcaacc
gcttcccagggtctcgccctgatgcacgaggtccttttcatcgccgctggaatgcgcctt
ccgatagtcatcgccgttggaaaccgttcactcagtgccccgatcaacatctggaacgac
tggcaggacagcataagcgagcgcgatactgggtggctccagttctacgccgagaacaac
caggaggcccttgacctcatactcatcgccttcaaggtagccgaggacgaaagggttctc
ctcccggcgatggtcggcttcgacgcgttcatcctcacccacacggttgagccggttgag
attcccgaccaggaggtcgtcgacgagttcctcggcgagtacgagccgaagcacgcctac
cttgatcctgccagaccgataacgcagggcacccttgccttccctgcccactacatggag
gctaggtacaccgtctgggaggccaacgagaacgccaagaaggtcatcgacgaggccttt
accgagttcgagaagaagttcggtaggaagtaccagaaggtcgaggagtacaggaccgac
gatgccgacataatcttcgtcaccatgggctcactcgcaggaaccgtcaaggagtacgtt
gaccacctcagggagaagggtctgaaggtcggcgctgcgaagctcaccgtttaccgcccg
ttcccgaccgaggaagttagggaacttgccaagaaggccaaggttctcgcgctccttgag
aagaacgtcaccttcagcgtcggtggggcactcttccaagacttcagcagggcactggtt
aacctcgacgagaggcccaagatagtcgacttcatcctcggcctcggtggcagggacgtc
acattcaagaacctagacgaggcgttggccatagcccagaaggccctcaacggtgaggag
tttgatgaggtcaactgggttggcctgaggaaggagatactgtga

DBGET integrated database retrieval system