KEGG   Thermococcus peptonophilus: A0127_09655Help
Entry
A0127_09655       CDS       T04728                                 

Definition
(GenBank) aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tpep  Thermococcus peptonophilus
Pathway
tpep00030  Pentose phosphate pathway
tpep01100  Metabolic pathways
tpep01120  Microbial metabolism in diverse environments
tpep01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tpep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A0127_09655
Enzymes [BR:tpep01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     A0127_09655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AMQ19404
UniProt: A0A142CXA2
LinkDB All DBs
Position
complement(1775209..1777068)
Genome map
AA seq 619 aa AA seqDB search
MKGWWGRILRVDLTNNKVQVQEYPKEVAKKFIGGRGLAAWILWNEAKNVDPLGPENKLVF
ASGPFNGLPTPSGGKMVVAAKSPLTGGYGDGNLGTMATVHLRKAGYDALVVEGKAKKPVY
IYIEDDNVSILSAEGLWGKGTFETERELKKIHGKNVGVLSIGPAGENLVKYAVVISQEGR
AAGRPGMGAVMGSKNLKAVVIKGTKEIPVADKEKLRELSQEAYNAILNSPGYPFWKRQGT
MAAVEWTNENSALPTRNFSDGSFEFARSIDGYTMEGMKVKQRGCPYCNMPCGNVVLDAEG
QESELDYENVALLGSNLGLGKLNEVSVLNRIADDMGMDTISLGGSIAHVMEAVEKGILKD
GPTFGDFKGAKQLALDIAYRRGELGNLAAEGVKAMAEKLGTHDFAMHVKGLEVSGYNCFI
YPAMALAYGTSSIGAHHKEAWVIAWEIGTAPIEGEKAKKVEYKITYTPEKAAKVIELQRL
RGGLFEMLTACRLPWVEVGLDINYYPKLLEAITGVKYTWDDLYAAADRLYALIRAYWVRE
FNGNWDRKMDYPPRRWFIEGLKSGPYKGQHLDEKKYDELLSEYYRLRGWDERGIPKKETL
QKLGLEEVIPELEKVTKLE
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggatggtggggaagaatcctcagggttgatcttaccaacaacaaggtccaagtg
caggagtacccaaaggaagtcgcgaagaagttcattggcggcaggggtctggccgcatgg
attctctggaacgaggccaagaacgttgatccacttgggcccgagaacaagctcgttttt
gcatctggcccgttcaacggtctcccaacaccgagcggaggtaagatggttgtcgctgcc
aagagcccgctcaccggtggctacggtgacggaaaccttggaaccatggcgaccgttcac
ctcaggaaagccggatatgatgccctagtcgtcgagggcaaggccaagaagccggtctac
atctacatcgaggacgacaacgtgagcatcctgagcgctgagggcctctggggcaagggg
accttcgagaccgagagggagcttaagaagatacacggcaagaacgtcggtgtcctcagc
atcggccctgccggagaaaacctcgtcaagtacgccgttgtgatctctcaggagggcagg
gccgccggaaggcccggtatgggtgcagtcatgggaagcaagaacctcaaggccgtcgtc
ataaagggaaccaaagagatacccgtcgctgacaaggagaagctcagggagctgagtcag
gaagcatacaacgcaatcctgaactcgccgggctatcccttctggaagagacagggtacg
atggcggccgtcgagtggacgaacgagaactcagcccttccaaccaggaacttcagcgat
ggaagctttgagttcgcccgctcaatagacggctacacaatggagggaatgaaggtcaag
cagcgtggctgcccctactgtaacatgccctgtggaaacgtcgtgctcgacgctgaaggt
caggagagcgagctcgactacgagaacgttgcactgctcggttctaacctggggctcgga
aagctcaatgaggtctcggtcctcaacaggatagcggacgacatgggtatggacaccatc
agcctcggcggctcaatagcccatgtaatggaggccgttgagaagggcatcctcaaggac
ggtccgaccttcggcgacttcaagggtgccaagcagctcgccctcgacatcgcttaccgc
aggggagagcttggaaacctcgcggcagagggcgttaaggccatggccgagaagctcggc
acccacgacttcgccatgcacgtgaagggccttgaggtaagcggttacaactgcttcatc
tacccggcgatggcactcgcttatggaaccagctcaataggtgcccaccacaaggaggcc
tgggtcatagcctgggagatcggaaccgctccaatagagggcgagaaggccaagaaggtc
gagtataagataacttacactccggagaaggctgctaaggtgatagagctccagcgcctc
aggggtggcctctttgagatgctcaccgcgtgcagacttccgtgggtcgaggtcggtctc
gacatcaactattatccgaagctcctcgaggccatcaccggcgtcaagtacacctgggac
gatctctacgccgctgccgacaggctctacgcactcataagggcctactgggtcagggag
ttcaacggcaactgggacaggaagatggactacccgccgagaagatggttcatcgagggc
ctcaagagcggcccgtacaagggccagcacctcgacgagaagaagtacgatgaacttctc
agcgagtactacaggctcaggggctgggacgagcgcggaatcccgaagaaggagaccctc
caaaagctcggcctcgaagaggtcattccggagctggagaaggttaccaagctcgagtga

DBGET integrated database retrieval system