KEGG   Thermococcus peptonophilus: A0127_10180Help
Entry
A0127_10180       CDS       T04728                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
tpep  Thermococcus peptonophilus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo APH ABC1 RIO1
Motif
Other DBs
NCBI-ProteinID: AMQ19625
UniProt: A0A142CXX3
LinkDB All DBs
Position
unnamed:complement(20403..22112)
Genome map
AA seq 569 aa AA seqDB search
MGHMFDDDILEGIIKLFIVIVIISVIFGRFAWFFIFIVIFMWGGHLVRHLLRDITKPRKK
YRYRYPKPTPPAPPVPREDMRELLRKSVIVELPPKVHAGEEIPLTVGFRNLLRGTINVEI
DLSDLSRYFDLSSTRVYFRSVKPGEYVSQSVRVVPRRPGKVSAKVVARSGIVSAKVKVST
EIIERPKVEPKTPLPVPVPAQGGSKNSAEGPRTPLEELFARYKNVELIGEGGFARVYRAE
RKDGSVVALKIPMSLTEAGGKAFLREVRNWSLLSHPNIVELYDYNIFPVPYLEMEYCESS
LAKLEKPLNPEKAARIIFDVAEGIKYAHSKGIIHRDLKPSNILLKNGRAKVSDWGLSKLL
KESRTTQSVSFTPLYAAPEQISSRFGGTDERTDVWQIGAVLYELLTGRPPFEGEDFVEVA
SKITLEEPVPPSHLNPEAKPLEHVVMKCLAKKKEERYGSVEELQRDIAEFLGTSYREKLS
RSVSVRDLSRSAYFAGELFLLYLKLNDLVNALKYADDLIHYARGETKRELVKLQEQLKLR
LENGLEVPEELIEKAEIIVHRIKLGFKGV
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgggccatatgtttgacgacgacatccttgagggaattatcaagctcttcatagttata
gtgataatctccgtcatcttcgggcgctttgcgtggttcttcattttcatagtgatattc
atgtggggcggccatttggtgaggcacctgctcagggacataacaaaaccgaggaaaaag
taccggtaccgctatcccaaacccactccgccagccccccctgttccgagagaggatatg
agggagctcctccggaagtccgtgatagtcgagcttccgccgaaggttcacgcgggcgag
gagatacccctcaccgttggcttcaggaacctgctcaggggaacgataaacgtcgagata
gacctcagcgacttatcaaggtacttcgacctcagctccacgagggtttacttcaggagt
gtgaagccgggtgaatacgtctcccagagcgtgagggtggtcccgaggaggcccggaaaa
gtcagcgccaaggttgtcgcccgctccggaattgtgagtgctaaagtcaaggtgagcacc
gaaataatagagaggccaaaggtggagcccaaaactccccttccagtccccgttccggca
caaggaggttcgaaaaattcagcagaaggtccccgcaccccgctggaggagctctttgcg
aggtataagaacgtcgagctaataggtgagggcggctttgcgagggtttacagggcggag
aggaaagacggaagcgtcgtggccctcaagatacccatgagcctaactgaagcgggggga
aaggcattcctcagggaagtgcggaactggtccctcctcagccatcccaacatagtcgag
ctctacgactacaacatcttcccagttccatacctggagatggagtactgtgagagctcg
ctggccaagctcgaaaaacccctaaatccggagaaggctgcgagaatcatcttcgacgtt
gctgagggcataaagtacgcccactccaaaggtatcatccaccgtgatctcaagcccagc
aacatcctcctcaagaacggcagggcgaaggtgagcgactgggggctaagcaagctcctc
aaggagagtaggactactcaatcagtgagcttcacaccgctctacgccgctccggaacag
ataagctcccgcttcggaggaactgatgagaggacagatgtgtggcagattggagcggtg
ctctacgagcttctcacggggaggccccccttcgagggcgaggacttcgtcgaggtggcg
tcaaagataacccttgaggagcctgtccctccgagccaccttaacccggaagcaaagccc
ctcgagcatgtagtcatgaagtgcctcgcgaagaaaaaggaggagcgctacgggagcgtt
gaagaacttcagagggacatagcggagttcctcggcactagctaccgcgaaaaactcagc
aggagcgtctcggttagagacctttcgaggagtgcgtacttcgcaggggagctgtttctc
ctgtatctgaagctcaacgacctcgtgaacgcactcaagtacgctgatgacctgattcac
tacgcgaggggtgaaactaagagggagcttgtgaagctacaggagcagctgaaactgcgc
cttgagaacggcctggaagtccccgaggagctcatagagaaggcggagataatagtccac
aggataaagctgggctttaagggggtgtga

DBGET integrated database retrieval system