KEGG   Tetrapisispora phaffii: TPHA_0C02880Help
Entry
TPHA_0C02880      CDS       T02235                                 

Gene name
TPHA0C02880
Definition
(RefSeq) hypothetical protein
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
tpf  Tetrapisispora phaffii
Pathway
tpf04011  MAPK signaling pathway - yeast
tpf04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:tpf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    TPHA_0C02880 (TPHA0C02880)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    TPHA_0C02880 (TPHA0C02880)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tpf01001]
    TPHA_0C02880 (TPHA0C02880)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tpf03036]
    TPHA_0C02880 (TPHA0C02880)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tpf04147]
    TPHA_0C02880 (TPHA0C02880)
Enzymes [BR:tpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     TPHA_0C02880 (TPHA0C02880)
Protein kinases [BR:tpf01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   TPHA_0C02880 (TPHA0C02880)
Chromosome and associated proteins [BR:tpf03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     TPHA_0C02880 (TPHA0C02880)
Exosome [BR:tpf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   TPHA_0C02880 (TPHA0C02880)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Kdo RIO1 FTA2
Motif
Other DBs
NCBI-GeneID: 11533476
NCBI-ProteinID: XP_003684875
UniProt: G8BRR5
LinkDB All DBs
Position
3:623723..624778
Genome map
AA seq 351 aa AA seqDB search
MGKKIVFNISSEFQLKSLLGEGAYGIVCSATHKPTGETVAIKKIEPFDKPLFALRTLREI
KLLKHFQHENIISLFDLQKPDSFENFNEVYIIQELMQTDLHRVISTQQLSDDHLQYFIYQ
TLRAVKILHSCNVIHRDLKPSNLLINSNCDLKVCDLGLARIGKDNDSDGDEQDTSAMTEY
VATRWYRAPEVMLTAAKYTKAMDIWSCGCILAELFLKRPIFPGKDYRHQLMLIFGFVGTP
DEEGLQCIESQRARQYIASLPSYDPVNVEEVFKGVNPLGIDLLQKMLVFDPAKRITAEEA
LNHPYLDVYHDPNDEPDGEPIPLNFFEFDKYKSTLTTKDLKNLLWQEIFSS
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaaaaatagtcttcaatatatcaagtgaatttcaattaaaatcgcttttagga
gaaggtgcgtatggcattgtatgttctgccacccataaacccactggtgaaacagtggca
ataaagaagattgagccatttgataagccattatttgcattaagaacattaagagaaatc
aaattgttgaaacacttccagcatgaaaatattatatcgctttttgatcttcaaaaacct
gattcattcgagaactttaatgaggtttacatcattcaagaactcatgcaaactgaccta
catcgtgttatctctacacaacaactatccgatgaccatttacaatactttatatatcaa
actttaagagcagtaaaaattttgcatagttgtaatgtaattcacagggatttgaaacct
tctaatttattaataaattctaattgtgatttgaaagtatgtgatttaggattagctaga
ataggaaaggacaacgattcggatggtgatgaacaagataccagtgcgatgactgaatat
gtagccacgagatggtacagagcacctgaagtcatgttaacggcagctaaatacaccaaa
gccatggacatatggtcatgtggatgtatcttagctgaattatttctaaagagaccaatt
tttcccggtaaagattacaggcatcaacttatgttaatatttggatttgtcggaacaccc
gatgaagaaggtttacaatgcatagagagtcaaagagcaaggcagtacatcgcatcatta
ccatcttacgatccagtgaacgttgaagaagttttcaaaggagtgaacccattaggtatt
gatttattacaaaaaatgttagtattcgacccagccaagagaataacagctgaagaagca
ttaaatcatccatatctagatgtctaccatgatcctaacgatgaaccggatggtgaacct
ataccccttaacttctttgaattcgacaagtataaaagtacgttaactacaaaggatctt
aaaaacttattatggcaagaaattttctcttcttaa

DBGET integrated database retrieval system