KEGG   Tetrapisispora phaffii: TPHA_0D01570Help
Entry
TPHA_0D01570      CDS       T02235                                 

Gene name
TPHA0D01570
Definition
(RefSeq) hypothetical protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
tpf  Tetrapisispora phaffii
Pathway
tpf00500  Starch and sucrose metabolism
tpf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TPHA_0D01570 (TPHA0D01570)
Enzymes [BR:tpf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     TPHA_0D01570 (TPHA0D01570)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15 DUF3834
Motif
Other DBs
NCBI-GeneID: 11534576
NCBI-ProteinID: XP_003685231
UniProt: G8BSH6
LinkDB All DBs
Position
4:complement(323974..325947)
Genome map
AA seq 657 aa AA seqDB search
MRKGIYLYDCYLDNNNDVIANNRWRSKFRKFAFFISICLATTFVCVSLGGCSLASFGYIK
SNFLFNDGYSSISSSSNFNTVNVTITDFNSHFLKTSQIQGLNYYKDDQIYNFFYEKIKLK
KIQSQLINKNEFEDWLQAQKSNSLERLLFNVMDKNLNGHENLLNKNEKIIEGAIVASQST
QDPNYFFQWIRDSAIVINTVTDNIFDEKNYNITLVGTFLKYLNISYNLQRTDNLSGGSVP
DGDLKGLGEPKWNVDNSPYNDNWGRPQNDGPPLRIIAILNFYSRLSIFNDANNSNVTVHD
LIKEYNMKYTKLETNFTSETDIFNEIIYYDLKFIINNWKERNFDIWEEVNGIHFFTSLMQ
LTSIKMTLNYMKTSGSFTTTGKLKPMYDSLIDTYEKMYKFILLDSGFIINNDSKHHIVET
PEILSYRSGLDIATIIASLLSHSTDNEFLDNSLPFDVDDSSILNSLYYLINEMSQLYPVN
LNRKSMNMGVALGRYPEDVYDGYKKSEGNPWFLATSSASELIYQLIIKIKTLKQDILIPL
ATESKNNNDHDIFWTLIFDNIAHIDTKESNIKNGNSYQLLLPYNSRSFNQTLENLFKYGD
SFLDCVREHSSEEGNLSEQFNKYTGFLQGAQDLTWSYNSFLSACQSRDKVINMMSFK
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagggtatttacttatatgattgttatttggataataataacgacgtgattgcc
aataatagatggagatctaagtttcggaagtttgcttttttcatttcgatatgtttggct
acgacttttgtttgtgtttcattaggaggatgttcgttggcaagcttcggatatattaaa
tctaatttcctattcaatgacggctacagttctatctcttcttcgtctaatttcaataca
gtcaacgtcacgatcacggattttaatagccactttctgaaaacgtcacaaattcaggga
ctcaactattacaaggatgatcagatatacaattttttctatgaaaaaattaaactaaag
aaaattcaatcgcaattaattaataaaaatgaattcgaagactggttacaagcacagaaa
tcaaactctttagagagattattgttcaatgtgatggataaaaatttaaatggccacgaa
aatttattaaataaaaatgaaaaaataatagaaggtgcaattgttgcgtcacaatcaaca
caagatccaaattactttttccaatggataagggacagtgcgatagttattaataccgtg
actgacaatatatttgatgaaaaaaattataatattacattagttggcacgttcttaaag
tatttaaatatatcttataatctacaaagaactgacaatttatcaggtggaagtgtaccc
gatggcgatttaaagggattaggtgaaccaaaatggaatgtggataactcaccatataat
gataattggggtagaccgcagaatgatggacctccgttacgaataatagcaattctgaat
ttttattcaagactttcgattttcaatgatgcaaacaattctaatgttactgttcacgat
ttaattaaagagtataatatgaaatacacgaagttggaaacaaattttacttcagaaact
gatattttcaatgaaattatttattacgatttgaaatttattattaataattggaaagaa
agaaattttgatatttgggaagaagtcaatggtatacattttttcacttctttaatgcaa
ttgacttcaattaaaatgacgttaaattatatgaaaacttccggatcttttacaactact
gggaaattgaaaccaatgtacgactcgttgattgatacttatgaaaagatgtataaattc
atattattggattctggatttattatcaacaatgactctaaacatcatattgttgagacg
ccagaaatcctgtcatatagaagcggtcttgacatcgcaacaatcattgcttcattatta
tcacattcaacagataatgaatttctcgataattccttaccatttgatgtggatgattca
agcatattgaattctttgtattatttaatcaatgaaatgtcgcaattgtatccggttaat
ttaaatagaaaatcgatgaatatgggtgtcgctttaggaagatatccagaagatgtttac
gatgggtacaagaagtcagaaggaaatccatggtttttagcaaccagtagtgcatcagaa
ttgatttatcaattaatcatcaagatcaagacattaaaacaggatatactcattccatta
gcaacagagagtaaaaataataatgatcatgacattttctggactctgatctttgataat
atagcccacatagatacgaaggaaagtaacataaagaatggtaacagctatcaattattg
ttaccttacaattcacgttccttcaaccaaactttagaaaatttattcaaatacggcgat
tcgttcctcgactgtgttcgagaacactcaagtgaagaaggtaatctaagtgagcaattc
aataagtacacaggtttcctacaaggcgctcaagatttgacttggtcatataactctttc
ttgtcagcatgtcaatcgagagacaaagtcataaacatgatgagttttaaataa

DBGET integrated database retrieval system