KEGG   Tetrapisispora phaffii: TPHA_0F00210Help
Entry
TPHA_0F00210      CDS       T02235                                 

Gene name
TPHA0F00210
Definition
(RefSeq) hypothetical protein
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
tpf  Tetrapisispora phaffii
Pathway
tpf00020  Citrate cycle (TCA cycle)
tpf00190  Oxidative phosphorylation
tpf01100  Metabolic pathways
tpf01110  Biosynthesis of secondary metabolites
tpf01130  Biosynthesis of antibiotics
tpf01200  Carbon metabolism
Module
tpf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tpf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tpf_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:tpf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TPHA_0F00210 (TPHA0F00210)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    TPHA_0F00210 (TPHA0F00210)
Enzymes [BR:tpf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     TPHA_0F00210 (TPHA0F00210)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_7 Fer4_9
Motif
Other DBs
NCBI-GeneID: 11535335
NCBI-ProteinID: XP_003685942
UniProt: G8BUS6
LinkDB All DBs
Position
6:complement(32290..33087)
Genome map
AA seq 265 aa AA seqDB search
MFLNLQKNLLSTGRRAFSTTAKMATKQHEPRFKTFKIYRWNPDKPTEKPRLQSYKVDLDD
CGPMVLDALLKIKNEQDSTLTLRRSCREGICGSCAMNIGGRNTLACICKIDQDNSKELKV
YPLPHMYVVKDLVPDLTHFYKQYKSIQPFLQRKTFPADGKENLQSIADRKKLDGLYECIL
CACCSTSCPSYWWNQEEYLGPAVLMQAYRWLIDSRDQASHKRKEMLQNSMSLYRCHTIMN
CTKTCPKGLNPGKAIAEIKKSLAFD
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtttttgaatttacaaaagaatttgttgtcgacaggcagaagggccttctcgaccacg
gccaaaatggcgacgaaacagcatgagccaaggttcaagactttcaagatttatagatgg
aatccagacaaaccaaccgaaaaaccccgtttgcaatcttacaaagttgatctggatgac
tgtggtcccatggttctagacgcactattgaagatcaagaacgagcaagacagtacgttg
actttgagaagatcgtgcagagaaggtatctgtggttcatgtgcaatgaacattggaggt
agaaacactttggcatgtatctgcaaaatcgatcaggataactcaaaagagttgaaagtg
tatcccttgccacacatgtacgtggtcaaggacttggtaccagatttaactcatttttac
aaacagtacaagtcgatccagcctttcttacagagaaaaacgttccctgctgatgggaag
gagaatctgcagtctatagcggaccgtaagaaactggatggactatacgagtgtatcctt
tgtgcctgttgttcaacctcttgtccatcgtactggtggaaccaggaagagtacctaggt
cctgctgtcttgatgcaagcataccgttggttaatcgactcgagagatcaagcctcgcac
aagagaaaagagatgctacaaaactcaatgtccctgtacagatgccacactatcatgaac
tgtacaaagacatgtccaaagggcctgaaccctggtaaagccatcgccgagattaaaaaa
tctttggcattcgactaa

DBGET integrated database retrieval system