KEGG   Tetrapisispora phaffii: TPHA_0G02090
Entry
TPHA_0G02090      CDS       T02235                                 

Gene name
TPHA0G02090
Definition
(RefSeq) hypothetical protein
  KO
K12766  serine/threonine-protein kinase MDS1/RIM11 [EC:2.7.11.1]
Organism
tpf  Tetrapisispora phaffii
Pathway
tpf04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:tpf00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    TPHA_0G02090 (TPHA0G02090)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tpf01001]
    TPHA_0G02090 (TPHA0G02090)
Enzymes [BR:tpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     TPHA_0G02090 (TPHA0G02090)
Protein kinases [BR:tpf01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   TPHA_0G02090 (TPHA0G02090)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Choline_kinase APH
Other DBs
NCBI-GeneID: 11535831
NCBI-ProteinID: XP_003686479
UniProt: G8BVW7
LinkDB
Position
7:complement(429178..430527)
AA seq 449 aa
MSSTNGVATAIVHKQVYFGHANNKTKYLSIIKDLNTDNNRNTNNNGNDLLTNENNEVVNT
INDRDNNNNTKDNNNEDGSDDTNTIEDEPVTISYPTTEVIGHGSFGVVFTTTIIETNELV
AIKKVLQDKRFKNRELEIMKLINHKNVINLKYFFYEKDSHNEIYLNLIIDYMPQSLYQRL
RHFVHQRSPMPRFEIKCYMYQIFKALNYLHNNINVCHRDIKPQNLLVNPSTFELKICDFG
SAKQLKITDPNVSYICSRYYRAPELIFGSTNYTNQIDIWSTGCVMAELLLGQPMFPGESG
IDQLVEIIKILGTPSKQDICAMNSNYMEHKFPQIKPIPLNNVFKKEDEVTVSLLTNILKY
DPMERLNSLQCLCQKYFDELRIITTGVGLNPDGDNLTINNEQNLNLNQIKSLVDKLELLD
FNVSEEFNHLNSIQLDAIKLKLLPNIIPG
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgtcatccactaatggggttgcaactgcaatagtgcataaacaagtatattttggccat
gccaataacaaaacaaaatatctatcgataataaaagatcttaatacagataataacagg
aatactaataacaacggtaatgacctattaactaatgaaaataatgaagttgtaaatact
attaatgatagagataataataataatactaaagacaacaataatgaagatggcagtgac
gatacaaacaccattgaagacgagccagtgaccatttcgtatcctaccacagaagtgatt
ggtcatggttcatttggtgtggtgtttaccactacaataattgaaactaatgaattagta
gcaattaaaaaagtattgcaagataaaagattcaagaacagagaattagaaataatgaaa
ttaattaatcataaaaatgtaatcaatttgaaatattttttctatgaaaaagattcacat
aatgaaatttatttaaatttaattattgattacatgccacaatcattatatcagaggcta
agacattttgtacaccaaagatcaccaatgccaagattcgaaatcaaatgctatatgtat
caaatttttaaagcattgaattatttgcacaataatattaatgtatgccatagagatatt
aaaccgcagaacttattagtaaatccaagtacatttgaattgaaaatttgtgattttggt
agtgcaaaacaattgaaaataactgatccaaatgtatcatatatttgttcaagatattac
agagctccagagttaatctttggttcaacaaactatacaaatcaaatcgacatttggtca
acaggttgtgtaatggcagaattattgttaggtcaaccaatgtttccaggcgaaagtggt
attgatcaattggtggagattattaaaatattaggtaccccttcaaaacaagatatttgt
gcaatgaattcaaattatatggaacataaatttccacaaattaaacctataccattaaat
aatgtctttaagaaagaagacgaggtaacagtgagtttattaacaaatatattgaagtat
gatccaatggaaagattgaattcattgcaatgtttgtgtcaaaaatattttgatgaatta
agaataataactactggtgttggtttaaaccccgacggtgataatttaacgattaataac
gaacaaaatttgaatctcaatcaaatcaaatcgttagtcgataaattagaattgttagat
tttaacgtctcagaagaattcaatcatttgaatagcattcaattagatgctataaaattg
aaattactgcctaatatcataccagggtaa

DBGET integrated database retrieval system