KEGG   Tetrapisispora phaffii: TPHA_0H03100Help
Entry
TPHA_0H03100      CDS       T02235                                 

Gene name
TPHA0H03100
Definition
(RefSeq) hypothetical protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
tpf  Tetrapisispora phaffii
Pathway
tpf00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:tpf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    TPHA_0H03100 (TPHA0H03100)
Enzymes [BR:tpf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     TPHA_0H03100 (TPHA0H03100)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     TPHA_0H03100 (TPHA0H03100)
    1.1.1.-  
     TPHA_0H03100 (TPHA0H03100)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C Pyr_redox_3 Prim_Zn_Ribbon Pyr_redox_2 Pyr_redox NAD_binding_7
Motif
Other DBs
NCBI-GeneID: 11534023
NCBI-ProteinID: XP_003686947
UniProt: G8BWR2
LinkDB All DBs
Position
8:complement(736924..738102)
Genome map
AA seq 392 aa AA seqDB search
MRALAYFGQNDVRFTTDLKEPVISADDELIIAVSYCGICGTDLKEYTEGAIFFPPDGGHN
EISGNGLPQAMGHEISGVVEKVGKGCKTFKVGDHVVVEPTGTCKDRYRWPESQNANKPMC
SACSIGMTNICAHLALCGAGLESGGFAERLVINEAHVHKIPDHMPLDIGALIQPISVCWH
AVKVAHYKKGGSALIIGGGPIGLGTILALKGFGCEYIVLSEPATIRREYAGKMGAKVYDP
TGVPFDESVKTLREMGPNGDGFDYTFDCSGLPITLNAAIECCTFRGTAVNVAVWNNKPVE
FYPMDITHQEKRYTGSMCYTSEDFEEVIDAFETDKIDIASASHMITNKVPIEDGVDGAIM
RLLNDKGHVIKILLTPNNNGELRDRRPVELNV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagagctttagcttacttcggtcaaaatgatgttagattcacaacagatctaaaagaa
ccagtcatttctgcagatgatgaattgatcattgctgtttcatattgtggtatctgtggt
acagatttaaaagaatacaccgaaggtgcaatttttttcccaccagatggtggtcataat
gaaatttcaggtaatggtttacctcaagcaatgggtcatgaaatatctggtgttgttgaa
aaagtcggaaaaggttgtaagacttttaaagtaggcgaccacgttgttgttgaaccaact
ggtacttgtaaggatagataccgttggcctgaatcccaaaatgctaataaaccaatgtgc
agtgcttgttcaattggtatgactaatatttgtgctcatttagctttatgtggtgctggt
ctggaaagtggtggatttgctgaaagattagttatcaacgaagctcatgttcataaaatc
ccagaccatatgccattggatattggtgctttaattcaaccaatttcggtttgttggcat
gctgttaaagttgctcactacaagaaaggtgggtctgctttgattatcggtggtggtcca
attggtttaggtactattttggctttgaaaggttttggctgtgaatatattgtattatcc
gaaccagctacaatcagaagagaatatgctggtaaaatgggtgccaaggtttatgaccca
actggtgtgccatttgacgaatctgtgaaaacattaagagaaatgggtccaaatggtgat
gggttcgactacacttttgattgttctggtttaccaattactttaaatgccgccattgaa
tgttgtactttcagaggtacagctgtcaatgtggccgtctggaataataaaccagtcgaa
ttctacccaatggacattacacaccaagaaaagagatataccggttctatgtgttacaca
tctgaagatttcgaagaagtcattgatgcttttgaaacagataaaattgatattgcgtca
gcatctcatatgattacgaacaaagtcccaattgaagatggtgttgatggcgccatcatg
agattattaaacgataaaggtcatgttataaaaattttattaacaccaaataacaacggt
gagttacgtgatagaagaccagtagagctgaacgtttag

DBGET integrated database retrieval system