KEGG   Treponema pallidum subsp. pertenue Gauthier: TPEGAU_0670Help
Entry
TPEGAU_0670       CDS       T01750                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
tpg  Treponema pallidum subsp. pertenue Gauthier
Pathway
tpg00473  D-Alanine metabolism
tpg00550  Peptidoglycan biosynthesis
tpg01100  Metabolic pathways
tpg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:tpg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    TPEGAU_0670 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TPEGAU_0670 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    TPEGAU_0670 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tpg01011]
    TPEGAU_0670 (ddl)
Enzymes [BR:tpg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     TPEGAU_0670 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:tpg01011]
 Precursor biosynthesis
  Amino acid ligase
   TPEGAU_0670 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AEZ59932
LinkDB All DBs
Position
complement(736044..737234)
Genome map
AA seq 396 aa AA seqDB search
MVHVTLLYGGRSAEHDVSVRSARFVARTLCLQHTVMLIGITRRGVWYAQPACALEQLCTG
TVALSIQEDEKRRVCLVPGGGTAGAFVIAGMPCVTDVVFPVLHGSYGEDGTVQGLLEMLQ
VPYVGCGVCASALAMDKVKAKMLWQAAGLPVLPFVFFRKDAWRMHMQEFVAQLETRLGYP
LFVKPAQAGSSVGASPVQTRAPLIPAIEAAFQWDEVVLVERYVRAREIECALSGNGPYTV
HGAGEVIAQGAFYDYEEKYADASVARVLVTAPLETAQYEQITTLALRAYEALGLTGLARV
DFFLLETGEVYVNEVNTMPGFTSISLFPQICQAAGVAPQDLMAQLLSCARERFAARAALS
TDLHAHVCAPSVTAAHDPDAQGDDWDQRDSNPLPTA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtggtgcatgtgacgcttttgtacggaggccgttctgcagagcacgatgtttctgtacgt
tctgcacgttttgtggcgcgcacgttgtgcttacaacacaccgtaatgctcatcggtatt
acccgtcgtggcgtgtggtatgcgcagcctgcgtgtgcattagagcagttgtgtaccggc
actgtcgcgctcagtattcaggaagatgaaaagaggcgcgtgtgtcttgtcccgggaggt
ggtactgcaggcgcttttgtcatagcggggatgccgtgtgtcacggatgtggtattcccc
gtattgcatggcagttatggggaagatggtacggtgcagggtttgcttgagatgctgcag
gtgccgtacgtggggtgtggagtgtgtgcaagtgctcttgcgatggataaggtaaaggca
aagatgctatggcaggcggcgggacttcccgttttaccgtttgtctttttccgtaaagat
gcatggcgtatgcatatgcaagaatttgttgcgcagcttgaaacacgccttggctatcct
ctttttgtaaagccagctcaagcaggcagttccgtaggagccagtccagtgcagacgcgt
gcaccgcttatccctgcgattgaagcggcttttcagtgggatgaagtggtgttggtggag
cgatatgtgcgcgcgcgagaaattgaatgtgcgctcagtgggaacggaccctatactgta
catggggcaggagaggtgattgcgcagggagccttttatgactacgaggaaaaatatgct
gatgcaagtgtcgcgcgtgtactcgttacggctcctcttgagactgcccagtacgaacag
attaccacacttgccctgcgcgcatacgaagcattaggactcacgggtctggcgcgggtt
gatttttttctgttagaaacgggagaagtatatgtgaacgaagtaaacacgatgccgggt
tttacgtcgatatcactctttccccaaatatgtcaggctgcaggtgttgcaccgcaggac
ttaatggcacaactcctttcttgcgcacgagagcgctttgcagcgcgcgccgcactgagc
accgacttgcacgcccacgtgtgtgcgccctcggtgactgctgcacatgaccccgatgcg
caaggggacgactgggaccagagggactcgaaccccctccctactgcttag

DBGET integrated database retrieval system