KEGG   Treponema primitia: TREPR_0649Help
Entry
TREPR_0649        CDS       T01507                                 

Gene name
pyk
Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
tpi  Treponema primitia
Pathway
tpi00010  Glycolysis / Gluconeogenesis
tpi00230  Purine metabolism
tpi00620  Pyruvate metabolism
tpi01100  Metabolic pathways
tpi01110  Biosynthesis of secondary metabolites
tpi01120  Microbial metabolism in diverse environments
tpi01130  Biosynthesis of antibiotics
tpi01200  Carbon metabolism
tpi01230  Biosynthesis of amino acids
Module
tpi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tpi_M00002  Glycolysis, core module involving three-carbon compounds
tpi_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:tpi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TREPR_0649 (pyk)
   00620 Pyruvate metabolism
    TREPR_0649 (pyk)
  Nucleotide metabolism
   00230 Purine metabolism
    TREPR_0649 (pyk)
Enzymes [BR:tpi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     TREPR_0649 (pyk)
Membrane trafficking [BR:tpi04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    TREPR_0649 (pyk)
Exosome [BR:tpi04147]
 Exosomal proteins
  Proteins found in most exosomes
   TREPR_0649 (pyk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C PEP-utilizers HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: AEF83567
UniProt: F5YK37
LinkDB All DBs
Position
complement(3671619..3673412)
Genome map
AA seq 597 aa AA seqDB search
MKIIRNTHIICTMGPTTESLEMVRSLIRKGMNLARFNFSHGEHGYHGAMIARVREAAAAE
GVPIALILDTKGPEIRTGKIRDNGIVELVSGEKLDVIAEADATALYGEEGAFTSKGRITV
SYQSLADDIRPGARILIADGIFSLDVLSLEGRVMRCRVETGGELGGRKNVNILGVHTRLP
AMSEKDMDDLRFGHEQEMDYVAASFIRKASDVTAIQKYLVSIGSDMQVIAKIEDDEGLQN
IEEIIRVSAGIMVARGDLGVQIPPERVPLEQKRIISLCNKEGKPVITATQMLDSMTHNSR
PTRAEAGDVANAILDGTDCVMLSGETANGAWPEAAVEVMDRIALAAESSEEYRNNMWERR
RTFHEQDLGQVIAGAAVNTADAIGASCIIMPTLSGLTAQLVSKRRPQRCIVAATPSEKVR
RRLLLYWGVVPVEVQREEDSEAMIQGAIGAAIKEGFAASADKVVVVAGLPVNSPITTNSI
RVHVIGTVLGRGARGFGGRCTGRVIKAENLVEAARWLRSKGGEILLTHTLDESFTPIIRI
VDGVILEGTSELSREHIKNINPNVVYVAQVPGAMNLFEENSTVTLDGAEKLIYEGTL
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataatccgaaatacccacattatttgtaccatgggacctaccacagaatcgttg
gaaatggtccgttccctaatccgtaaggggatgaacctggcccggtttaatttttcccat
ggggaacatgggtatcatggggcgatgatagcccgggtccgggaggccgccgccgccgag
ggggttcccattgccctgatcctggataccaagggcccggaaattcgcaccggcaagatc
agggacaacggtattgtcgagttggtttccggtgaaaaattggatgtgatcgccgaagcc
gatgcgacggccctctatggtgaggagggcgcttttaccagtaaagggcggatcaccgtg
agttaccaatccctggcagatgatatacggccaggcgcccggatccttattgcggatggg
attttttccctggatgttctttcccttgagggacgggtcatgcgctgccgggttgaaacc
gggggagaattggggggcaggaaaaatgtgaacatcctgggggtgcacacccggcttccg
gctatgtctgaaaaggatatggatgatctccggtttggccatgaacaggagatggattat
gtggcggcttcctttatccgcaaggcttcggatgttacggccatacagaaatacctggtc
tccatcggttcggatatgcaggttattgctaaaattgaagacgatgaggggctgcaaaat
atcgaagaaattatccgggtttctgccgggataatggtagcccggggagacctaggggtg
cagataccccctgaacgggtgcccctggaacagaaacggatcatcagcctctgcaataaa
gagggaaagccggtgatcaccgccacccagatgttggactccatgacccataactcccgg
cctacccgggctgaagcgggggatgtggccaacgctatcctggacggcacggactgcgtg
atgctttccggagaaaccgccaacggcgcctggcctgaagcggcggtagaagtgatggac
cgcatcgccctggcggcggagtcttcggaggaataccggaacaacatgtgggaacgccgc
agaaccttccacgaacaggatctgggccaggtcatcgccggggctgcggttaacaccgcc
gacgctatcggcgcttcctgtatcatcatgcccaccctgagcggccttaccgcccagctg
gtgagcaagcgccgtccccaacgctgtattgtggcggctacccccagtgaaaaggtgcgc
cggcggctcctcctctattggggggtggtcccagtggaggtacagagggaagaggattcg
gaggccatgatccagggggctatcggtgccgcgatcaaggaaggctttgccgcatctgcg
gataaggtggtggtagtggcggggctgccggtcaattcgcccataaccaccaacagcatc
agggtccatgtaatcggtaccgtactgggccggggtgcccggggcttcggcggccgctgt
accggccgggtgattaaggcggaaaaccttgtagaggcggcccggtggcttcggagcaag
gggggggaaatactcctgacccataccctggatgaatcctttacccccattatccgcatc
gtggacggcgttatccttgaggggacttcggaattgtcccgggagcatatcaagaatatc
aaccccaatgtggtctatgtggcccaagtaccgggggcaatgaatttatttgaggaaaat
tccacggtaaccctggatggggcggagaaactgatctacgaagggaccctgtag

DBGET integrated database retrieval system