KEGG   Treponema primitia: TREPR_2364Help
Entry
TREPR_2364        CDS       T01507                                 

Definition
(GenBank) phosphoenolpyruvate mutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
tpi  Treponema primitia
Pathway
tpi00440  Phosphonate and phosphinate metabolism
tpi01100  Metabolic pathways
tpi01120  Microbial metabolism in diverse environments
tpi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tpi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    TREPR_2364
Enzymes [BR:tpi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     TREPR_2364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase CTP_transf_like ComA
Motif
Other DBs
NCBI-ProteinID: AEF84551
UniProt: F5YHL5
LinkDB All DBs
Position
complement(1863986..1865284)
Genome map
AA seq 432 aa AA seqDB search
MKTVYLGMTGDIIHPGIINIIQEAEKYGEVMVGLLTDSAIASHKRIPFLTYDQRKAVVEN
IKGVARVAPQEEWSYVPNLKKYRPDFIIHGDDWKSGPLSKIRDDVYALMAEQGGTVIEVP
YTKGINSTAMNEAQHSIGTTPDIRLRALRRLIEVKPVVRIMEAHSGLSGLIIENLEIGKD
DGVHSFDGMWSSSLTDSTSKGKPDIEAVDLTTRLQDLTNVLECTTKPIIYDGDTGGKSEH
FVFTVRTLERNGVSAVIIEDKVGLKKNSLFGTEVNQELASIPEFSEKISAGKRAQVTRDF
MIIARLESLIAGFPVSHALERAEAYVKAGADGIMIHSKEKSGGDIKEFCEKFHSGYSHVP
IVLVPTTYNQFTEKELVAWGAKIIIYANHMLRSSYPAMLKTARVILENERSLEADSLCMS
IKEILELIPGTK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactgtctatctaggaatgaccggagatatcatccacccagggatcatcaatatt
attcaggaagctgaaaaatacggtgaagttatggtgggactcctcactgattctgccatc
gcatcccacaaacgtatcccctttctcacctacgatcaacggaaagcggtggtggaaaac
ataaaaggtgttgcccgggtggcgccccaggaagaatggagttatgtgccgaaccttaaa
aaataccggcccgattttatcatccatggggatgattggaaaagtggtcccttgagtaaa
atccgggatgatgtgtatgcgcttatggcggaacagggcggcacggtcatagaagtacct
tacaccaaggggatcaactccaccgccatgaacgaagcccagcattccatcggcactaca
ccggacatcaggctcagggctttgcgccggctcattgaggtaaagcctgtggtgcggatc
atggaagcccactcgggcctttcggggttgatcatcgaaaacctggaaatcggtaaggat
gacggggttcacagctttgatggcatgtggtcatcaagcctcaccgattctactagcaag
ggaaagcccgacattgaggctgtagacctaaccacccgtctccaggatctcaccaatgtt
ctggaatgtaccaccaagcccatcatctatgacggtgacaccggcgggaaaagcgagcac
tttgtatttaccgtgcgtaccctggaacgaaatggagtatccgcagtaattattgaagac
aaggtcgggttaaaaaagaattccctcttcggtactgaggtaaaccaggaactcgcttcc
atcccggagttttcagaaaagataagcgccggaaagcgggcccaggtaacccgggacttt
atgatcattgcccggctggaaagcctcattgcagggtttccggtttcccatgccctggag
cgggccgaagcctatgttaaagcaggcgccgatggtatcatgatccacagcaaagaaaag
tccgggggggatattaaagagttctgtgaaaaatttcattccggttacagccatgtgccc
atcgttttagtgcccaccacctataaccaattcaccgaaaaggaacttgtcgcctggggg
gccaagatcatcatctacgccaaccacatgctccgttcttcctaccctgcaatgcttaag
accgccagggttatcctggaaaatgagcggtccctggaagcggattccctctgtatgtcc
atcaaggaaatcctggaactaattcccggaacaaagtaa

DBGET integrated database retrieval system