KEGG   Thermococcus piezophilus: A7C91_06245Help
Entry
A7C91_06245       CDS       T04941                                 

Definition
(GenBank) RNA ligase
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
tpie  Thermococcus piezophilus
Brite
Enzymes [BR:tpie01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     A7C91_06245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_ligase DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: ANF22817
UniProt: A0A172WH93
LinkDB All DBs
Position
1152361..1153503
Genome map
AA seq 380 aa AA seqDB search
MVSSHFRNILLKLGIPEERLSVLEGKGGLVEDEFEGIRYVRFRDSAKGFRRGTLVFENGE
VVLGFPHIKRVVQLENGIRRVFKNRPFYVEEKVDGYNVRVVKVGDKVLALTRGGFVCPFT
TERVEDFINFDFFMDYPNLVLAGEMAGSESPYLVEGPPYVTEDIQFFLFDIQEMGSGKSL
SVEERLKLAEEYGIPHVEVFGVYDRRRIDDLYDLIERLHRERREGIVMKSPDMKRIAKYV
TPYANINDVRIGSHIFFDLPYGYFMQRIKRLAFYLAEKHIKGEEFDEYAKALGKALLRPF
VESIHEVANGGEIEETFTVRVKSITTAHKMVTHFERLGIKIHIEDIEDLKNGYWRITFKR
VYPDATKEIRELWNGLAFVD
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggtaagctctcacttcaggaacattctgctcaagctcggcatccctgaggagcgatta
tcagtcctcgagggtaaaggaggcctcgtcgaagacgagtttgagggtatcagatacgtc
cgcttccgcgattctgccaagggcttcaggcgtggaaccctcgtcttcgagaacggcgag
gtggttctgggctttccccacataaaacgcgtcgtccagcttgagaacgggataaggcgc
gtcttcaagaacaggcctttctatgtcgaggaaaaggtcgatggatacaacgtcagggtc
gttaaagtgggagataaggttctcgccctcacaagaggaggcttcgtctgtcccttcacg
acggagagggttgaggacttcataaatttcgacttcttcatggactacccgaacctcgtt
ctagctggagagatggccgggtctgagagcccttacctcgtcgagggtccgccctacgtg
acggaggatattcagttcttcctctttgacattcaggagatggggagtgggaagagcctt
tccgtagaggaaaggctgaagctcgctgaagaatacggaattcctcacgttgaagtgttc
ggagtttatgatcgacgccgcatcgacgacctctacgacctcattgagaggttgcatcgc
gagagaagggaaggaatcgtcatgaagagccctgacatgaagagaatcgcgaagtacgta
acgccctacgccaacatcaacgacgtcaggataggctcgcacatattctttgacctgccg
tacggctacttcatgcagagaataaagcggctggctttctatctagcagaaaagcacatc
aagggtgaggagtttgacgaatatgccaaggccctagggaaggcactgctacggcccttc
gttgagagcatccatgaggtggccaacggcggcgagatagaggagacctttactgttcgc
gtcaagagcataaccaccgcacacaagatggtcacccacttcgagagactcggcatcaag
atacacatcgaggacatcgaggatttaaagaacggctactggcggataaccttcaagcgg
gtttatcctgacgccacgaaggagataagggagctgtggaacgggctggcgtttgtggac
tag

DBGET integrated database retrieval system