KEGG   Thermococcus piezophilus: A7C91_09885Help
Entry
A7C91_09885       CDS       T04941                                 

Definition
(GenBank) aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tpie  Thermococcus piezophilus
Pathway
tpie00030  Pentose phosphate pathway
tpie01100  Metabolic pathways
tpie01120  Microbial metabolism in diverse environments
tpie01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tpie00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A7C91_09885
Enzymes [BR:tpie01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     A7C91_09885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ANF23634
UniProt: A0A172WJK3
LinkDB All DBs
Position
1802560..1804419
Genome map
AA seq 619 aa AA seqDB search
MKGWWGRILRVDLTNNKVWVQEYSPDVAQQFIGGRGLAIKILWDEVKGADPLGPENKLVF
AAGPFNGLPTPSGGKLVVAAKSPLTGGYGDGNLGTMATVHLRKAGYDAIVVEGKAKKPVY
LYIENDNVSILSAEGLWGLDTFKTEEELKKIHGKNVGILSIGPGGENLVRYAVVMSQEGR
AAGRPGMGAVMGSKKLKAVVIKGTKEIPVADKKKLQELSKEAYKAIQSSPAYPFWKRQGT
MAAVEWTNENSALPTRNFSDGSFEFARSIDGYTMEGMKVKQRGCPYCNMPCGNVVLDAEA
QESELDYENVALLGSNLGLGKLNEVSVLNRLADMYGLDTISLGVSISFVMEAVERGLLKE
GPTFGDFKGAKQLIEDIAFRRGELGNFAAEGVMRMSQKLGDDSFAMHVKGLETSGYNCFI
YPAMALAFGTSSIGAHHKEAWVIAWEIGTAPIEGEQAKKVEYKITYNPEKAAKVIELQRL
RGGLFEMLTACRLPWVEVGLSLDYYPKLLEAITGVKYTWDDLYRAADRVYALIRAFWVRE
FNGKWDRKMDYPPKRWFIEGLKSGSYKGMHLDEKQYDKLLSEYYRLRGWDERGIPKEETL
KELGLEEVIPELEKVTKLE
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggatggtggggaaggatcctccgggtcgacttgaccaacaacaaagtctgggtg
caggagtattctcccgatgtggctcagcagtttatcgggggtagaggtctcgcaatcaag
atcctctgggatgaagtcaaaggtgccgacccgcttgggccggagaacaagctcgttttt
gctgcgggtccgttcaacggtttaccaactccgagcggcggtaagctcgtcgtcgccgcc
aagagcccgctcaccggcggttacggtgatggtaacctcggcaccatggcgactgtccac
ctgagaaaggccggttatgatgccatcgtcgttgagggcaaggccaagaagccggtttac
ctctacatagagaacgacaacgttagcatactcagcgctgagggcctctggggtctcgac
accttcaagacagaggaggagctcaagaagatacacggcaagaacgtcggaatccttagc
atcggtccgggtggagaaaaccttgtccgctacgccgtcgtcatgtcacaggagggcagg
gccgctggaaggcccggtatgggtgccgtaatgggaagcaaaaagctcaaggccgtcgtc
ataaagggaacgaaggagataccagtcgctgacaagaaaaagctccaggagctctcaaag
gaggcctacaaggcaatccagagctcgccggcttaccccttctggaagaggcagggaacc
atggccgctgtcgagtggaccaacgaaaacagcgccctgccgacgaggaacttcagcgac
ggttccttcgagtttgcacgctcgatcgatggatacaccatggagggcatgaaggtcaag
cagcgcggttgtccgtactgtaacatgccctgtggaaacgtcgtcctcgatgccgaagcc
caggagagcgagcttgactacgagaacgttgccctgctcggctcaaacctcggccttggc
aagctcaatgaggtttcggtcctcaacaggctcgccgacatgtacggcctcgacaccatt
tcactcggtgtatcgatatcattcgtgatggaggctgtagagaggggactccttaaggaa
ggtccgacctttggggacttcaagggcgccaagcagctcattgaggacatcgcctttagg
aggggagagctcggcaacttcgccgccgaaggcgtcatgaggatgagccagaagctcggc
gatgacagcttcgccatgcacgtaaagggccttgagacgagcggttacaactgcttcatc
tatccggccatggcgctcgccttcggtaccagctcaatcggtgctcaccataaggaggca
tgggtcatcgcctgggagattggcaccgctccaatcgagggtgagcaggccaagaaggtc
gagtacaaaatcacctacaacccggagaaggccgctaaggttatcgagctccagcgcctc
aggggaggcctctttgagatgctcaccgcatgtaggcttccatgggtcgaggtcggcctg
agcctcgactactatccgaagctcctcgaggccattaccggcgtaaaatacacctgggac
gacctctacagggcagccgacagggtctacgcactcatcagggccttttgggtcagagag
ttcaacggcaagtgggacagaaagatggactacccgccgaagaggtggttcatcgagggc
ctcaagagcggctcgtacaagggcatgcacctcgatgagaagcagtacgacaagcttctc
agcgagtactacaggctcaggggatgggacgagcgcggaatcccgaaggaggagaccctc
aaggagctcggcctcgaggaggttatcccagagctcgagaaggttacaaagctcgagtga

DBGET integrated database retrieval system