KEGG   Treponema pallidum subsp. pallidum SS14: TPASS_0229Help
Entry
TPASS_0229        CDS       T00716                                 

Definition
(GenBank) DNA polymerase, bacteriophage-type
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
tpp  Treponema pallidum subsp. pallidum SS14
Pathway
tpp03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:tpp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    TPASS_0229
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tpp03400]
    TPASS_0229
Enzymes [BR:tpp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     TPASS_0229
DNA repair and recombination proteins [BR:tpp03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     TPASS_0229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: ACD70655
UniProt: A0A0H3BIQ3
LinkDB All DBs
Position
238584..239417
Genome map
AA seq 277 aa AA seqDB search
MQGSGTVMYAVYGRLSPMHAGDRESIARFVRVVRDCLDLFRTEGIGPRPRNDSVILPNAA
CSPRNHAGKRAQSTADACVRSSDGSVYTDETLREEIFACRACELYQRRTHAVVGEGVADA
DVLVVGEAPGAEEDRSGRPFVGRSGKLLDAMLAAIGLSRQQNCYITNVVKCRPPRNRTPT
PHETACCARFLHAHLTLHRPCAILVLGRCAAQHMLQTTDGIGKLRGRFFTYQGIPLLATY
HPSALLRDEALKRPAWEDLKTFRARLLQLKQDAHMPI
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggatcgggtaccgtcatgtacgcagtttatggtaggctcagtcctatgcacgct
ggggacagagagagtatcgcacgcttcgtgcgtgtggtgcgcgattgtctggatttgttt
cgcaccgagggtattgggccccgtcctaggaatgattcggtaattttaccgaatgctgcg
tgttcaccgcgtaatcatgcaggaaagcgtgcgcagagcactgccgatgcgtgtgtgaga
agcagtgacgggtctgtatacacggacgaaaccttgcgcgaggaaatttttgcatgccgt
gcgtgtgaattgtatcaacggcgtacacatgcggtggtgggagagggtgttgcagacgca
gacgtgctcgtcgttggggaggcccctggagcggaagaagatcgaagcggtcgtccgttc
gtaggacggtcaggtaaattgctggacgcaatgcttgcggcgattggactttcgcgtcag
caaaattgttatatcaccaatgtggttaagtgccggccgccaaggaaccgcacaccaaca
ccccacgagactgcctgttgtgcacggttcctccatgcgcatcttacgctgcatcgcccg
tgtgctattttggtgctcggccgctgcgccgcacagcacatgctccaaacaaccgatggt
attggcaagttgcgcgggcgcttttttacctatcaggggattccccttctggctacgtac
catccgagtgcgttgttacgggatgaagcgctgaaacgtccggcgtgggaggatctcaaa
acgtttcgtgcacggttgctgcagttgaagcaggacgcacacatgccaatataa

DBGET integrated database retrieval system