KEGG   Tsukamurella paurometabola: Tpau_2999Help
Entry
Tpau_2999         CDS       T01228                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
tpr  Tsukamurella paurometabola
Brite
KEGG Orthology (KO) [BR:tpr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Tpau_2999
Enzymes [BR:tpr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Tpau_2999
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored FAD_binding_2 HI0933_like Glutaredoxin FAD_binding_3 Thi4 K_oxygenase DAO AlaDh_PNT_C FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ADG79594
UniProt: D5UU91
LinkDB All DBs
Position
complement(3108316..3109893)
Genome map
AA seq 525 aa AA seqDB search
MLEASLATQLKSLLANVTMPVELVSTLDDGPKSAELAELLDEIAGMSEHITHDRTGDDPR
TPSFLIRRAGTDIAVQFAGIPLGHEFSSLVLALLQVGGHPSKEAAELLEQVRELDGDYHF
ETYFSLSCQNCPDVVQALNLMSVLNPRITHTAIDGSLFQDEVDSRQVMAVPTVFVNGEPF
DSGRMTLEQIVGKLDDGAAERTAASLAEKDPFDVLVVGGGPSGATASVYAARKGIRTGIV
AERFGGQVLDTMAIENFTSVSYTEGPKFAAELENQVRQYDVEIMNTQRGAHLRRDEATGM
ISVELTSGAALQSRTVVISTGARWRSMDVPGEAEYRNKGVTYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVSHVTLIEFDSELRADQVLQRKLRSLPNVDVLVSAMTTEVLGDGG
KVTGLTYTSRTSDESHTLELDGVFVQIGLLPNTEWLEGTLELSARGEIVVDEAGRTSVPG
VFAAGDCTTVPFKQIVVAAGAGATAALSAFDHIIRTDVPADVVAG
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaagcctcgctcgccactcaactcaagtccctgctcgcgaacgtcacgatgccc
gtcgagctggtttcgacgctcgatgacggcccgaagtcggccgaactcgcggagctgctc
gacgagatcgcgggcatgtccgagcacatcacccacgaccggaccggcgatgacccgcgg
accccgtcgttcctgatccggcgcgcaggcaccgacatcgcggtgcagttcgccggaatt
cctctggggcatgagttctcgtcgctcgtgctcgccctgctccaagtgggtggtcatccg
tcgaaggaggccgccgagctgctggagcaggtccgcgagctcgacggcgactaccacttc
gagacctacttctcgctgtcctgccagaattgcccggacgtggttcaggcactgaacctc
atgtccgtgctcaacccgcgcatcacgcacaccgcgatcgacggctcgctgttccaggac
gaggtcgatagccgccaggtgatggccgtgccgaccgtcttcgtcaacggcgagccgttc
gactccggccgcatgactctagagcagatcgtcggcaagctcgacgacggtgccgccgag
cgcaccgccgcctcgctcgccgagaaggacccgttcgacgtgctcgtcgtgggcggcggt
ccctccggtgccaccgcttcggtgtatgccgcccgcaaggggattcgcaccggtatcgtc
gccgagcgcttcggcggccaggtgctcgacaccatggccatcgagaacttcacctcggtc
agctacaccgagggcccgaagttcgcggccgagctcgagaaccaggtgcgccagtacgac
gtcgagatcatgaacacccagcgcggtgcgcacctgcgccgcgacgaggcgaccggcatg
atctccgtcgagctcacgagcggcgctgcgctgcagtcgcgcaccgtcgtcatttccacg
ggcgcccggtggcgttccatggacgtgcccggcgaggccgagtaccgcaacaagggcgtc
acctactgcccgcactgcgatggcccgctgttcaagggcaagcgcgttgccgtgatcggc
ggcggcaactcgggtgtcgaggccgcgatcgacttggcgggcatcgtctcccacgtcacg
ctcatcgagttcgactccgaactgcgcgccgatcaggtgctccagcgcaagctgcgcagc
ctgcccaacgtcgatgtcctcgtcagtgcgatgaccaccgaggtgctcggcgacggcggt
aaggtcaccggcctcacctacacgagccgcaccagcgatgagtctcacacgctcgagttg
gacggggtcttcgtgcagatcggcctgctgcccaacaccgagtggctggagggcactctg
gaattgagcgcccgcggcgagatcgtcgtcgatgaggcgggccgcacctcggtgcccggt
gtgttcgccgccggcgactgcaccaccgtgccgttcaagcagatcgtggtcgccgcaggt
gccggcgccacggccgcgctgagtgccttcgaccacatcatccgtaccgacgtcccggcc
gacgtcgtcgccggctga

DBGET integrated database retrieval system