KEGG   Thermococcus profundus: A3L09_02520Help
Entry
A3L09_02520       CDS       T05153                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
tprf  Thermococcus profundus
Brite
Enzymes [BR:tprf01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     A3L09_02520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_ligase DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: ASJ02219
LinkDB All DBs
Position
468653..469795
Genome map
AA seq 380 aa AA seqDB search
MVSSYFMSLLLKIGVPEDRLLVLEGKGGIVEDEFEGIKYIRFRDSAKGFRRGTVVFENGE
VVLGFSHIKRVVQLENGIKRVFKNRPFYVEEKVDGYNVRVVKVGDRVLALTRGGFVCPFT
TERIGDFVNFEFFGDYPNLVLAGEMAGPESPYIVEGPPYVMEDIRFFLFDIQDKGTGKSL
PVEERYKLAEEYGIPQVERFGLFDRSRIDDLYGLIERLSRENREGIVMKTPDMKRIAKYV
TPYANINDIKIGSHIFFDLPHGYFMGRIKRLAFYLAEKHVKGDDFDEYAKALGKALLRPF
VESIHEVAQGGDIEEVFTVRVKNISTAHRMVTHFERLGVKIHIEDIEDLKNGYWRITFKR
VYPDATREIRDLWKGLAFVD
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggtaagctcgtactttatgagcctgctccttaagatcggcgttccggaggacaggctc
cttgttctcgagggcaaggggggcatagtcgaggacgagttcgagggaatcaagtacatc
agatttcgggattctgcgaagggcttccgcagggggacggtagtcttcgagaacggagaa
gtcgttcttggtttttcccacataaagcgcgtcgtccagcttgagaacgggataaagcgg
gtcttcaagaacaggcccttctacgttgaggagaaggtcgacggctacaacgtccgcgtc
gttaaggttggggatagggttcttgccctaacgaggggaggtttcgtctgcccgttcacg
accgagaggataggggacttcgttaactttgagttcttcggggactatccgaacctcgtc
ctcgctggagagatggccgggcctgagagcccgtacatagtggagggaccgccctacgtt
atggaggacattcggttcttcctcttcgacatccaggataagggaactggaaagagcctg
ccagtggaagaacgatacaagctggcggaggagtatggaataccgcaggtggagcgcttc
ggtctcttcgaccgttcacggatagacgacctctacgggctcatcgagaggctgagccgg
gagaatagggaaggcatcgtcatgaagacgcccgacatgaagaggatagccaagtacgtg
acgccctacgccaacatcaacgacataaagataggctcgcacatcttcttcgacctccca
cacggctacttcatggggcggataaagaggctcgccttctatctagccgaaaagcacgtt
aagggcgatgattttgacgagtatgctaaagcccttggaaaggcactgctgaggcccttc
gtcgagagcattcacgaggtcgcccagggcggtgatatagaggaagtcttcacggtgagg
gtcaagaacataagcacagcccacagaatggtcacccacttcgagaggcttggggtcaaa
attcacatcgaggacattgaagatttaaagaacggctactggaggataaccttcaagcga
gtctatccagatgcgacgagggaaatcagggatctatggaaagggctggcgttcgtggat
tga

DBGET integrated database retrieval system