KEGG   Thermococcus profundus: A3L09_03075Help
Entry
A3L09_03075       CDS       T05153                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
tprf  Thermococcus profundus
Pathway
tprf00500  Starch and sucrose metabolism
tprf01100  Metabolic pathways
tprf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tprf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A3L09_03075
Enzymes [BR:tprf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     A3L09_03075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3417
Motif
Other DBs
NCBI-ProteinID: ASJ02309
LinkDB All DBs
Position
550307..552799
Genome map
AA seq 830 aa AA seqDB search
MADVSHTVEDSIRKKLPYPLEDLVDLAYNYWWSWNRRATKLWEYIDPEHWREYKNPVKLL
LDTPRERFSELVRDDDFMNLYELVMDQFTAYMNPRSTWFSTNYPKWDKPIVYLCMEYGIS
KSLPIYSGGLGILAGDHVKTASDLGLPFIAVGLLYKHGYFRQEIDEKGGQREIFPEYRPE
EMPIKPVVGKDGKPLLIEVPIEDRIVHARAFEVNVGRIKLYLLDTDVPENSPDDRTICDY
LYNAETDKRIKQEILLGIGGMRLLRAIGIEPGVVHLNEGHPAFANLQRIAWYMEKGLSFT
EALSIVRGTTIFTTHTPVPAGHDRFPIEEVRKRLSGFLAGRDDLLELGREGDQINMTLLA
IRTSSYVNGVSQLHAEVSKGMWKDLWPGVPLNEIPIEGITNGVHTMTWVHNSMRKLFDRY
IGKVWREHTNIEGIWYAVERIPDDELWEAHLEAKRQFIELLRRKAIERNRRLGIDDPIPA
IDENALIIGFARRFATYKRATLLFTDLERLKKIVNNPERPVYLVFGGKAHPMDEGGKAFL
RRVYEVSQMPEFRGKIFVMENYDMGSARLMVAGVDVWLNNPRRPLEASGTSGMKAGLNGV
LNVSIYDGWWVEGYNGKNGWVIGEETTEPETEGDDPKDAESLYRLLEDEVIPTYYDNRAR
WIYMMKESIKSIAPRFSTHRMVKEYMDKFYSKAMSNHIWLTREGYRGAKEIAAWKDRVTS
AWDSVEIREVKVEGGKLSARVYLDGLKPEDVKVELYYGVRAEGYEIEKPHIVELRHPREL
GQDEWLYVYEGGALRHLGDPCWHYAVRVHPHHEKLPHKFLLGLVKWEGLD
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgtttcgcacactgttgaggattcaataagaaagaaactgccgtatcccctt
gaggatctggttgatctggcgtacaactactggtggagctggaacaggcgcgctactaaa
ctctgggagtacattgatcccgagcactggcgcgaatacaaaaaccctgttaaacttctc
cttgatactcccagagagcgcttcagcgagctggttagggacgacgactttatgaacctc
tacgagcttgttatggatcagttcacagcttacatgaacccccgctcgacgtggttctcg
acgaactatcccaagtgggacaagccgatagtgtacctctgcatggagtacggaataagc
aagagcctcccgatttactctggcggtctgggcatcctggccggcgaccatgttaaaact
gcgagcgaccttggactgccgtttatagccgttggcctgctctacaaacacggctacttc
cgtcaggaaatcgatgaaaagggcggccaaagggagatattcccagagtaccgtccggag
gaaatgcccataaagcccgtcgttggaaaagacgggaagcccctcttaatcgaggttcca
attgaggataggatagtccacgcccgggcctttgaggtgaacgtcgggcggatcaagctc
taccttctcgacactgatgtccctgaaaacagtccagacgacagaacaatctgcgactac
ctctacaacgccgagacagacaagaggataaagcaggagatactcctgggcatcggtggc
atgaggcttcttagggccataggaattgagcccggtgtggtccatctcaacgagggccac
cccgcctttgccaacctccagaggatagcctggtacatggagaagggcctgagctttacg
gaagccctgagcatcgtgaggggcactaccatattcaccacccacactcccgttcccgcc
ggtcacgacaggttcccgattgaagaggtcaggaagaggctctcgggattcctcgcgggt
agggatgatctcctggagctcggccgcgagggtgaccagatcaacatgacccttctcgcc
atcagaacatcaagctacgtcaacggcgtgagccagctccacgcagaggtaagcaaggga
atgtggaaagacctctggcccggggttcccctcaacgagatcccgatcgaggggataacc
aacggcgttcacacaatgacttgggtccacaacagcatgaggaagcttttcgatcgctat
attggcaaggtctggcgtgagcacacgaacattgagggtatctggtacgcggttgagagg
atccctgacgatgagctctgggaagcccacctcgaagccaagaggcagttcatcgagctc
ctgcggagaaaggccatcgagaggaacaggcggcttggaatagacgatccgataccagcg
atcgatgaaaacgcccttataataggctttgccaggaggtttgccacctacaagagggcc
acacttttgttcacggatcttgagaggcttaagaagatagtcaacaaccctgagaggccg
gtttatctcgtcttcggcggcaaggcccaccccatggacgaggggggtaaggccttcctc
aggagggtctacgaggtttcccagatgccggagttcaggggtaagatattcgtcatggag
aactacgacatgggaagcgcgaggctcatggttgctggcgttgacgtttggctcaacaac
ccgaggaggccccttgaggccagcgggacgagcggaatgaaggccggactgaacggggtt
ttgaacgtcagcatctacgacggctggtgggtggagggatacaacggaaagaacggctgg
gtgatcggtgaggagaccaccgaacctgagactgagggagatgatcccaaggatgcagag
agcctctacagactcctggaggacgaggttattccgacctactacgacaaccgtgcccgc
tggatctacatgatgaaggagagcataaagagcatcgccccgcgcttcagcacccacagg
atggtgaaggagtacatggacaagttctactccaaggccatgagcaaccacatctggctg
acgagggaaggatacaggggagccaaggagatagccgcatggaaggaccgtgttacatct
gcctgggacagcgttgagataagggaggtcaaggttgagggaggaaagctctcggctagg
gtctatctggacggtctcaagcccgaggacgtcaaggttgaactctactacggcgtcagg
gctgaaggctacgagatagagaagccccacatagttgagctgaggcacccccgcgagctg
ggacaggacgaatggctctacgtctacgagggcggtgccctgaggcacctcggcgacccg
tgctggcactacgccgtcagggttcatccacaccacgagaaattgccccacaagttcctg
ctcgggctcgtcaagtgggagggcttggactga

DBGET integrated database retrieval system