KEGG   Salipiger profundus: Ga0080559_TMP1124Help
Entry
Ga0080559_TMP1124 CDS       T04656                                 

Definition
(GenBank) succinate dehydrogenase subunit B
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
tpro  Salipiger profundus
Pathway
tpro00020  Citrate cycle (TCA cycle)
tpro00190  Oxidative phosphorylation
tpro00650  Butanoate metabolism
tpro01100  Metabolic pathways
tpro01110  Biosynthesis of secondary metabolites
tpro01120  Microbial metabolism in diverse environments
tpro01130  Biosynthesis of antibiotics
tpro01200  Carbon metabolism
Module
tpro_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tpro_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tpro_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tpro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ga0080559_TMP1124
   00650 Butanoate metabolism
    Ga0080559_TMP1124
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Ga0080559_TMP1124
Enzymes [BR:tpro01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Ga0080559_TMP1124
    1.3.5.4  fumarate reductase (quinol)
     Ga0080559_TMP1124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_7 Fer4_9 Fer4_16 Fer2 Fer4_22 Fer4_18
Motif
Other DBs
NCBI-ProteinID: APX21920
UniProt: A0A1U7D1G6
LinkDB All DBs
Position
complement(610560..611339)
Genome map
AA seq 259 aa AA seqDB search
MVQFTLPKNSRIRTGKTWPKPDGATNVRAFKIYRWNPEDGENPRVDTYHLDMDKCGPMVL
DALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGINTLACIYGLDEIKGDVKIYPLPHMP
VVKDLIPDLTHFYAQHASIMPWLETKTNRPEKEWKQSIEDRKKLDGLYECVMCASCSTAC
PSYWWNSDRYLGPAALLHAYRWIIDSRDEATAERLDQLEDPFKLYRCHTIMNCTKTCPKG
LNPAKSIAEIKKMMLERHV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggttcaattcacactccccaagaactcccgcatccgcaccggcaagacgtggccgaag
ccggacggcgcgaccaacgtccgggcgttcaagatctaccgctggaacccggaagacggc
gagaacccccgtgtcgacacctaccatctcgacatggacaagtgcggcccgatggttctg
gacgcgctcatcaagatcaagaacgagatcgacccgacgctgaccttccgccgctcctgc
cgtgagggcatctgcggctcctgcgcgatgaacatcgacgggatcaacacgctggcctgc
atctatggtctcgacgagatcaagggcgacgtgaagatctacccgctgccgcacatgccg
gtggtcaaggacctcatccccgacctcacgcatttctacgcgcagcacgcgtcgatcatg
ccgtggctcgagaccaagaccaaccgccccgagaaggagtggaagcagtccatcgaggat
cgaaagaagctcgacggtctctatgaatgcgtcatgtgcgcgtcctgctcgaccgcctgc
ccgagctactggtggaactccgaccgttacctcggaccggcagcgctgctgcacgcctac
cgctggatcatcgacagccgtgacgaagcgaccgccgagcgtctcgaccagctcgaggat
ccgttcaagctgtatcgctgccacacgatcatgaactgcaccaagacctgcccgaagggt
ctgaacccggcgaagtccatcgccgagatcaagaagatgatgctcgagcgtcacgtgtga

DBGET integrated database retrieval system