KEGG   Salipiger profundus: Ga0080559_TMP1128Help
Entry
Ga0080559_TMP1128 CDS       T04656                                 

Definition
(GenBank) succinate dehydrogenase subunit A
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
tpro  Salipiger profundus
Pathway
tpro00020  Citrate cycle (TCA cycle)
tpro00190  Oxidative phosphorylation
tpro00650  Butanoate metabolism
tpro01100  Metabolic pathways
tpro01110  Biosynthesis of secondary metabolites
tpro01120  Microbial metabolism in diverse environments
tpro01130  Biosynthesis of antibiotics
tpro01200  Carbon metabolism
Module
tpro_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tpro_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tpro_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tpro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ga0080559_TMP1128
   00650 Butanoate metabolism
    Ga0080559_TMP1128
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Ga0080559_TMP1128
Enzymes [BR:tpro01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Ga0080559_TMP1128
    1.3.5.4  fumarate reductase (quinol)
     Ga0080559_TMP1128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 FAD_binding_3 DAO PEARLI-4 HI0933_like
Motif
Other DBs
NCBI-ProteinID: APX21924
UniProt: A0A1U7D192
LinkDB All DBs
Position
complement(612759..614564)
Genome map
AA seq 601 aa AA seqDB search
MAAYEYETHNYDVVVVGAGGAGLRATLGMAEQGLRTACVTKVFPTRSHTVAAQGGIAASL
SNMGPDNWQWHMYDTVKGSDWLGDTDAMEYLARSAPAAVYELEHYGVPFSRTEEGKIYQR
PFGGHTTEFGEGPPVQRTCAAADRTGHAILHTLYGQSLKNNAEFYIEYFAIDLIMSEDGV
CQGVVCWKLDDGTFHVFNAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLAMQDM
EFVQFHPTGIYGSGCLITEGARGEGGYLTNSEGERFMERYAPTYKDLAPRDYVSRSMTME
IREGRGVGEHGDHIHLNLSHLPAEALAERLPGISESAKIFAGVDVTKEPIPVLPTVHYNM
GGIPTNYWGEVLNPTAENPNAVVPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAI
RAGEVVDRAAGKATPNQASVDKAFDRFDTVRNAEGGTPTAELRLEMQKTMQEDAAVFRTD
KTLKEGVEKMTAIAGKLSDLKVTDRTLIWNSDLMESLELTNLMPNALATIVGAEARKESR
GAHAHEDYPERDDDNWRVHTISRVDGNDVALSHRPVVLDPLTKEDAGGISLAKIAPKART
F
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atggctgcatacgaatacgagacgcataactatgacgtcgtggtcgtgggggccggcggc
gccggcctgcgtgccacgctcggcatggcagagcaggggctgcgcacggcctgcgtgacc
aaggtcttcccgacccggtcccacaccgtcgcagcgcagggcggtatcgccgcctcgctg
tcgaacatgggcccggacaactggcagtggcacatgtacgacaccgtgaaggggtcggac
tggcttggcgacaccgacgcgatggaatacctcgcgcgatcggcgcccgccgcggtctac
gagctcgagcactacggcgtgccgttctcgcgcaccgaagagggcaagatctaccagcgc
cccttcggcggtcacaccaccgagttcggtgaaggcccgccggtgcagcgcacctgcgcc
gccgccgaccggacaggccacgcgatcctgcacacgctctacggccagtcgctgaagaac
aacgccgagttctacatcgagtatttcgccatcgacctcatcatgtccgaagacggcgtg
tgccagggcgtggtctgctggaagctcgacgacggtaccttccacgtcttcaacgccaag
atggtcgtgctggccaccggcggctacgggcgcgcctatttctcggcgacctcggcacac
acctgcaccggcgacggcggcggcatggtggcccgcgcagggctggcaatgcaggacatg
gaattcgtgcagttccaccccactggcatctacggctcgggctgcctcatcaccgagggc
gcacggggcgagggcggctacctcaccaactccgagggcgagcgcttcatggagcgctac
gcaccgacctacaaggacctcgcgccgcgtgactacgtctcgcgctcgatgaccatggag
atccgcgaaggccgtggcgtgggcgagcatggcgatcacatccacctcaacctgtcgcac
ctgcccgccgaggcgctggccgagcgacttccgggcatctcagagtcggcgaagatcttt
gccggcgtggatgtcacgaaagagccgatcccggtgctgccgacggtgcactacaacatg
ggcggcattccgaccaactactggggcgaggtgctgaacccgaccgccgaaaatcccaac
gccgtcgtgccgggcctgatggccgtgggcgaggcgggctgtgcgtcggttcacggggca
aaccgccttggctccaactcgctgatcgacctcgtggtcttcggccgcgccgccgcgatc
cgcgccggcgaggtggtcgaccgggccgctggcaaggccacgccgaaccaggcgtcggtc
gacaaggccttcgaccggttcgacacggtccgcaacgccgagggcggcacgccgacggca
gagctgcggctcgagatgcagaagaccatgcaggaagacgcggcggtcttccggaccgac
aagaccctcaaggagggcgtcgagaagatgaccgccatcgcgggcaagctttcggacctg
aaggtcaccgaccggacgctgatctggaactcggacctgatggagtcgctcgagctgacc
aacctgatgcccaacgcgctggccaccatcgtcggtgcggaggcgcgcaaggagagccgc
ggggcgcacgcccacgaggactaccccgagcgcgacgacgacaactggcgggtgcacacc
atcagccgggtcgacggcaacgacgtcgccctcagccaccgcccggtggtgctcgatccg
ctgaccaaggaagatgccggcggcatcagcctcgccaagatcgcgccgaaggcccggacg
ttctga

DBGET integrated database retrieval system