KEGG   Salipiger profundus: Ga0080559_TMP1447Help
Entry
Ga0080559_TMP1447 CDS       T04656                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
tpro  Salipiger profundus
Pathway
tpro00240  Pyrimidine metabolism
tpro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpro00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Ga0080559_TMP1447
Enzymes [BR:tpro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Ga0080559_TMP1447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30 AAA_14
Motif
Other DBs
NCBI-ProteinID: APX22243
UniProt: A0A1U7D2A7
LinkDB All DBs
Position
932439..933020
Genome map
AA seq 193 aa AA seqDB search
MAKLYFNYSTMNAGKSTLLLQAAHNYGERGMEVYLLTARLDTRAGEGRIGSRIGLGREAD
TFTPEDDLFARIAAKHDARQLACIFVDEAQFLTETQVWQLARVADDLKIPVMAYGLRVDF
RGQLFPGSAVLLALADTLREVRTICHCGRKATMVIRKDGEGRVVIDGDQVQIGGNETYIS
LCRRHWREAFGKG
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagctctatttcaactactccaccatgaacgccggcaagtcgacgctgctgctg
caggcggcgcacaactacggcgaacgcgggatggaggtctacctgctcaccgcgcggctc
gacacccgcgccggcgagggccgcatcggctcgcgcatcgggctcgggcgcgaggccgat
accttcacccccgaggatgatctcttcgcccgtatcgcggcaaagcacgacgcgcgccag
ctggcctgcatcttcgtcgacgaggcgcagttcctgacagaaacgcaggtgtggcagctt
gcgcgcgtggcggacgatctgaagatcccggtgatggcctacgggctgcgtgtcgacttc
cggggccagctgtttccgggctccgccgtgctgctcgcgctggccgatacgctgcgcgag
gtgcgcacgatctgccattgcggccgcaaggcgacgatggtcatccggaaagacggcgag
ggccgtgtggtgatcgacggcgaccaggtgcagatcggcggcaacgagacctacatctcg
ctctgccgccggcactggcgcgaggcgttcggcaagggctga

DBGET integrated database retrieval system