KEGG   Salipiger profundus: Ga0080559_TMP3009Help
Entry
Ga0080559_TMP3009 CDS       T04656                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
tpro  Salipiger profundus
Pathway
tpro00630  Glyoxylate and dicarboxylate metabolism
tpro01100  Metabolic pathways
tpro01120  Microbial metabolism in diverse environments
tpro01200  Carbon metabolism
Module
tpro_M00165  Reductive pentose phosphate cycle (Calvin cycle)
tpro_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:tpro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Ga0080559_TMP3009
Enzymes [BR:tpro01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Ga0080559_TMP3009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N Cas_Csx9
Motif
Other DBs
NCBI-ProteinID: APX23805
UniProt: A0A1U7D6V9
LinkDB All DBs
Position
complement(2565622..2567085)
Genome map
AA seq 487 aa AA seqDB search
MLDNAKTVTDAKKRYSAGVMKYAQMGYWEPDYTPKDTDIIALFRITPQDGVDEVEAAAAV
AGESSTATWTVVWTDRLTACDKYRAKAYRVDPVPNSPGEFFAYIAYDLDLFEPGSIANLT
ASIIGNVFGFKPLKALRLEDMRLPVAYVKTFQGPATGIVVERERLNAYGRPLLGATVKPK
LGLSGRNYGRVVYEALKGGLDFTKDDENINSQPFMHWRDRFLYCMEAVNRASAATGEVKG
TYLNVTAGTMEEMYARAEFAKSLGSVIIMIDLVIGYTAIQSMAKWARDNDMILHLHRAGH
STYTRQRSHGVSFRVIAKWMRLAGVDHLHAGTVVGKLEGDPATTKGYYDIFREEYNPMAL
ENGVFFDQDWASLNKMMPVASGGIHAGQMHQLLTYLGEDVVLQFGGGTIGHPHGIAAGAT
ANRVALEAMVFARNAGRDIWNEGEDILRDAARTCTPLKQALDTWKDVTFDYASTDAPDFA
PTPEVSA
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgctggacaacgcaaagaccgttaccgacgccaagaagcgctacagcgcgggcgtgatg
aaatatgcccagatgggctactgggagccggactacacccccaaggacaccgacatcatc
gcgctcttccgcatcaccccgcaggatggcgtggacgaggtggaagcggcggcggccgtc
gcgggcgagtcctccacggcgacctggacggtggtatggaccgaccgtctgaccgcctgc
gacaagtaccgcgccaaggcctaccgcgtggacccggtgcccaacagccccggcgagttc
ttcgcctacatcgcctatgatctcgacctgttcgagccgggctcgatcgccaacctgacg
gcctcgatcatcggcaacgtcttcggcttcaagccgctgaaggccctgcggctcgaggac
atgcgcctgcccgtggcctacgtgaagaccttccaggggccggcgacgggcatcgtggtg
gaacgcgagcggctcaacgcctatggtcgcccgctgctgggcgccacggtgaagccgaag
ctggggctttcgggccgcaactacggccgcgtggtctacgaggcgctgaagggcgggctc
gacttcaccaaggacgacgagaacatcaactcgcagcccttcatgcactggcgcgaccgg
ttcctctactgcatggaagcggtgaaccgcgcctcggctgcgaccggcgaggtgaagggg
acctatctcaacgtcacagccggcacgatggaggagatgtatgcccgcgccgagttcgcc
aagtcgctcggctcggtcatcatcatgatcgacctcgtcatcggctacacggcgatccag
tcgatggcgaaatgggcgcgggacaacgacatgatcctgcacctgcaccgcgcggggcat
tcgacctacacccgccagcgcagccatggtgtcagcttccgcgtcatcgccaagtggatg
cgcctcgccggcgtcgaccacctgcacgcgggcacggtcgtgggcaagctcgagggcgac
ccggccaccaccaagggctactacgacatcttccgcgaggaatataacccgatggcgctg
gagaacggcgtgttcttcgaccaggactgggcctcgctgaacaagatgatgccggtggcc
tcgggcggcatccatgccggccagatgcaccagctgctcacctacctcggcgaagacgtg
gtgctgcagttcggcggcggcaccatcggccacccgcacggcatcgcggcgggggcgacg
gcgaaccgcgtggcgctcgaggcgatggtctttgcccgcaacgccggccgcgacatctgg
aacgagggcgaggacatcctgcgcgatgccgcccgcacctgcacgccgctgaagcaggcg
ctggacacgtggaaggacgtgaccttcgactacgcctcgaccgacgcgcccgacttcgcg
ccgacgcccgaagtgtccgcctga

DBGET integrated database retrieval system