KEGG   Salipiger profundus: Ga0080559_TMP4926Help
Entry
Ga0080559_TMP4926 CDS       T04656                                 

Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
tpro  Salipiger profundus
Pathway
tpro00473  D-Alanine metabolism
tpro00550  Peptidoglycan biosynthesis
tpro01100  Metabolic pathways
tpro01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:tpro00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Ga0080559_TMP4926
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Ga0080559_TMP4926
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Ga0080559_TMP4926
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tpro01011]
    Ga0080559_TMP4926
Enzymes [BR:tpro01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Ga0080559_TMP4926
Peptidoglycan biosynthesis and degradation proteins [BR:tpro01011]
 Precursor biosynthesis
  Amino acid ligase
   Ga0080559_TMP4926
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATPgrasp_ST ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: APX25722
UniProt: A0A1U7DC87
LinkDB All DBs
Position
complement(4579416..4580231)
Genome map
AA seq 271 aa AA seqDB search
MRAEGFNVTEVDAGPDLAQRLTALAPDVVFNALHGRWGEDGCVQGLLEWLGLPYTHSGVL
ASALAMDKERSKQVYRAAGLPVVESVLATKAEIMAAHVMAPPYVVKPYNEGSSVGVYIVH
EGSNAPPVLSDDMPETLMVETFAPGRELTTTVMEGRALTVTDIITEGWYDYDAKYTEGGS
RHELPAQVPQEIFDACLDYALRAHEALGCRGVSRTDFRWDESRGLDGLILLETNTQPGMT
PTSLVPEQAQTLGISFGALCRWMVEDASCNR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
ttgagggcagaaggtttcaatgtcaccgaggtcgatgccggccccgatctcgcgcagcgt
ctgaccgcgctcgcgccggatgtcgtgttcaacgctcttcacgggcgctggggcgaggac
ggctgcgttcagggtctgctcgagtggctgggcctgccctacacccactccggggtgctg
gcctcggcgctggcgatggacaaggaacgctccaagcaggtctaccgcgccgccgggttg
ccggtggtcgaaagtgtgctcgccacgaaggccgagatcatggccgcgcacgtgatggcg
ccgccctacgtcgtgaaaccctacaacgaagggtcctcggtcggggtctacatcgtgcac
gagggctcgaacgcgccgccggtgctgtcggacgacatgcccgagacgctgatggtcgag
accttcgcgccggggcgcgagctgacgaccacggtgatggaggggcgggcgctcacggtg
accgacatcatcaccgagggctggtacgactacgacgccaagtataccgagggcggctcg
cgtcacgaactgccggcacaggtgccgcaggagatcttcgacgcctgcctcgactacgcg
cttcgggcgcatgaggcgcttgggtgccgcggcgtgtcgcggaccgatttccgctgggac
gagagccgggggctcgacgggctgatcctgctcgagaccaacacccagccgggcatgacg
cccacctcgctggtgcccgagcaggcgcagacgctggggatttccttcggggcgctgtgc
cgctggatggtggaggacgcttcgtgcaatcgctga

DBGET integrated database retrieval system