KEGG   Thalassiosira pseudonana: THAPSDRAFT_1754Help
Entry
THAPSDRAFT_1754   CDS       T01078                                 

Definition
(RefSeq) predicted protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
tps  Thalassiosira pseudonana
Pathway
tps00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:tps00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    THAPSDRAFT_1754
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tps02000]
    THAPSDRAFT_1754
Enzymes [BR:tps01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     THAPSDRAFT_1754
Transporters [BR:tps02000]
 Other Transporters
  Pores ion channels [TC:1]
   THAPSDRAFT_1754
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_C_2 GST_C_5 GST_C GST_N_4 Glutaredoxin GST_C_3 GST_N
Motif
Other DBs
NCBI-GeneID: 7447618
NCBI-ProteinID: XP_002286964
JGI: 1754
UniProt: B8BRU8
LinkDB All DBs
Position
1
AA seq 557 aa AA seqDB search
MMPKPTTSYHLYHKFFLYSFALLSAEAFAPSSTALPLQLQTTSSASSSPSPAASSTAVFS
FNPLKSFFSSASQKGMMTSTSSQQAEQLQSLTASKLASLGMSSSWDEIRSMLESKQTDDE
RNFRKNLTKGYGKASPLHKLRLFDESNREEDVKVTLYRDSASWCPYCQKVWMTLEQKRIP
YRVEKINMRCYGDKPMSFMAMQPSGNIPVAVINGVTYNQSNDIMYALEEQFPDHEPLVPD
ATDSSKRMFAQELLRLERQIFSAWMYWLTSRDGSDGRLRENFISTLMEVERALTSMKGPF
FLGDKVSIVDMMFAPFLERMCASLLYFKGFQMRVASGKQSNYPAVNRWFGAMETLESYQL
TKSDYYTHCWDLPPQLGGCVPEAGSEPFQNAINGLTQGSWELPLSPHNGGIEPDWEWAGD
DNASKREAVERVSANWEAIVAFAARGAGKAGFPRYGAPLADPNAITNDAVHPFVSVALQL
LCQKLLADDDADAKCDKAMKEIAYLWKKEGGEEVIEKVVMSLEYLRDRTGVPRDMRLPAA
RQLRAHLNWAARVLSSA
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgatgccaaaacctaccacctcataccacttgtaccataagttcttcctgtactcgttt
gcgttgctgtcggcagaggcgttcgctccatcatcaacagcattgcccctccaactccaa
accacgtcatcggcatcgagttcaccttcaccagctgcttcgtccaccgccgtattcagt
ttcaacccattgaagtccttctttagtagtgcatcacaaaagggaatgatgacatcaacc
tcatcgcaacaagcggaacaactccaatcactcactgcatcaaaacttgcatcccttggc
atgagttcctcgtgggatgagattcgttcaatgcttgaatcaaagcaaactgatgatgag
agaaacttccgtaagaacttgacgaagggctatggaaaggcttcgccgttacacaagctt
cgtttgtttgatgagagcaatagagaggaagatgtgaaagtcactctctaccgcgactct
gcgtcttggtgtccttactgtcagaaggtctggatgacgctggaacaaaaacgtattccc
tatcgtgttgaaaagatcaacatgagatgctacggtgacaaacccatgtccttcatggca
atgcaaccgagtggaaacattcctgttgcagtcatcaatggagttacatacaatcaaagc
aatgatatcatgtacgctttggaagaacagtttcctgatcatgaaccgttggtgccggat
gcgacggattcttcgaagcgaatgtttgctcaagagttgttgagattggagcgacagatc
ttttcagcttggatgtattggctgacttctagagatggatcagacggaagattacgtgaa
aatttcatatctactttgatggaagtggagagagcattaacgtcgatgaagggaccattc
ttcttgggagacaaagtgtctattgtggacatgatgtttgctccatttcttgaaaggatg
tgtgcctcgttgctatacttcaagggattccaaatgcgggttgcctccggaaaacagagt
aactaccctgcagtgaaccggtggtttggggccatggaaactctggagtcgtatcaactt
acaaaatcggactattacacgcattgctgggatctccctccacaactaggtggctgtgta
cccgaagctggatccgaaccgtttcaaaacgcaatcaatggactcactcagggaagttgg
gaacttccactgtcaccacacaatggaggaattgagccggattgggaatgggctggagat
gataatgcatcaaaacgtgaagcagtagagcgtgtttctgcgaattgggaagcaatcgtt
gcttttgccgctcgaggtgcaggaaaagctggctttcctcgctacggagcccctctggct
gatccgaacgcaatcaccaatgatgcggtacatccgtttgttagtgttgctctgcaactc
ttatgtcaaaagttattggcagacgatgacgcagatgctaagtgtgataaggcaatgaaa
gagattgcatacctgtggaagaaggaaggaggtgaggaagttatcgaaaaggttgtaatg
agtctggagtacctccgtgaccgaacgggagtaccacgagatatgaggctaccggcagca
aggcaattgagagctcatctgaactgggctgctagagtgttatcgtcggcataa

DBGET integrated database retrieval system