KEGG   Thalassiosira pseudonana: THAPSDRAFT_42475Help
Entry
THAPSDRAFT_42475  CDS       T01078                                 

Definition
(RefSeq) succinate dehydrogenase flavoprotein subunit
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
tps  Thalassiosira pseudonana
Pathway
tps00020  Citrate cycle (TCA cycle)
tps00190  Oxidative phosphorylation
tps01100  Metabolic pathways
tps01110  Biosynthesis of secondary metabolites
tps01130  Biosynthesis of antibiotics
tps01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    THAPSDRAFT_42475
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    THAPSDRAFT_42475
Enzymes [BR:tps01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     THAPSDRAFT_42475
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 FAD_binding_3 Pyr_redox_2 GIDA DAO
Motif
Other DBs
NCBI-GeneID: 7441832
NCBI-ProteinID: XP_002293997
JGI: 42475
UniProt: B8CCT7
LinkDB All DBs
Position
14
AA seq 637 aa AA seqDB search
MLSAFARRASSKATKLASTAPTPTTAVRSLSTSTTGDYTIVDHTYDALVIGAGGSGLRAA
MGLSEAGFKTACVSKLFPTRSHTVAAQGGINAALGNMGPDDWRWHMYDTVKGSDWLGDQD
AIHYMCREAPKAVLELEEFGLPFSRTEEGKIYQRAFGGQSLDFGKGGQAHRCCAAADRTG
HAMLHTLYGRSLAFDTTYFIEYFAMDLLMTPDGQCVGAMALNMEDGTLHRIKAKNTVLAT
GGYGRTYFSCTSAHTCTGDGNAMAMRAGLANQDAEFVQFHPTGIYGAGCLITEGCRGEGG
ILRNSEGERFMERYAPSAKDLASRDVVSRAMTMEIREGRGVGPKKDHCYLHLDHLPAELL
AERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHLGEVIRTDFNADGSFNSDV
VVPGLFAAGEAACASVHGANRLGANSLLDIVVFGRACANRIAEIAKPGDAIADAPADVGM
DSVAELDKLRFATGSTPTSVIRGEMQHLMQDKAAVYRTEELLAEGKKEIDEVVQSFNDVH
VTDKSLIWNTDLVETLELRNLLGCAATTMHSAENRKESRGAHAHENYPDRLDDEWMKHTL
AYFDEKEGKTKIGYRPIHYYTLDEEECKTVPPVARVY
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgctctctgcattcgctcgcagagcctcctccaaggccaccaaactagcctccaccgcc
cccacaccaacaactgccgttcgatccctctccacctccaccaccggagactacacaata
gtagaccacacctacgacgcactcgtaatcggagccggaggatccggcctccgtgccgcc
atgggtttgagcgaggcggggttcaagaccgcgtgcgtgagtaagttgtttcctacgagg
agtcatacggtggcggcgcagggggggattaatgcggctctcgggaacatgggtcctgat
gattggaggtggcacatgtacgacaccgtcaaaggatccgactggctcggagaccaagac
gccatccactacatgtgccgagaggcaccgaaggcagtcctcgaactcgaagagttcggt
ctccccttctcccgtaccgaagagggcaaaatctaccaacgtgcctttggaggacagtct
ctagattttggaaaaggaggacaagctcatcgttgttgtgccgccgccgataggacgggg
cacgccatgttgcacactttgtatggaaggagtttggcgtttgatactacctacttcatt
gagtactttgcgatggatttgttaatgacccccgatggacagtgcgtcggagccatggcg
ttgaatatggaggatggaacgctgcacaggatcaaagccaagaacacagtgttggctacg
gggggatatggaaggacgtacttcagttgtacctcggctcatacttgcactggagacgga
aatgccatggcgatgagggcagggttggctaaccaggatgcggagtttgtgcagttccac
cctactggaatctatggagctggatgtctcattacggaaggatgtcgtggagagggtggt
atccttcgtaacagtgagggagaacgattcatggagcgctatgcacccagtgccaaggat
ttggctagtcgtgatgtggtgtctcgtgccatgactatggagattcgtgaggggcgtggg
gtgggacctaagaaggaccattgctatttgcatttggatcacttgcctgctgagttgttg
gcagagcgtttgcccggtatctcggagactgctgccatctttgctggagttgatgtcacc
aaggagcctattccagttttgccaacggttcattacaacatgggtggcatccctactaac
catctcggagaggtgattcgtaccgatttcaatgctgatggatctttcaactctgacgta
gtggtgcctggactctttgctgccggagaagctgcttgtgcctcggtacacggagccaat
cgactcggtgccaactctcttctggatatcgttgtctttggacgtgcctgtgccaatcgt
attgccgaaatcgctaaacctggagatgccatcgctgatgcaccagctgatgtgggcatg
gacagtgttgctgagttagacaaattgagatttgccactggatctacgccaacttctgtt
attcgtggggagatgcaacacctcatgcaagacaaagctgccgtgtaccgtaccgaggaa
ttgttggccgagggcaagaaggagattgacgaggttgtccaaagcttcaatgatgtccat
gttactgacaaatctctcatttggaatacagatctcgttgaaacccttgaacttcgcaac
ttgttgggatgcgctgcaactacaatgcattctgctgagaatcgtaaggagtctcgagga
gctcatgctcacgagaactaccccgatagattggacgatgagtggatgaagcacactttg
gcgtactttgatgagaaggagggaaagacaaagattggatacagacccattcattactac
actctggatgaggaggagtgtaagactgttcctcctgtggcacgtgtgtactaa

DBGET integrated database retrieval system