KEGG   Thermotoga petrophila: Tpet_0508Help
Entry
Tpet_0508         CDS       T00525                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K22231  scyllo-inosose 3-dehydrogenase [EC:1.1.1.-]
Organism
tpt  Thermotoga petrophila
Pathway
tpt00562  Inositol phosphate metabolism
tpt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Tpet_0508
Enzymes [BR:tpt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     Tpet_0508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 FAD_binding_3 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ABQ46530
UniProt: A5IK07
LinkDB All DBs
Position
complement(503801..504985)
Genome map
AA seq 394 aa AA seqDB search
MKAVRLHAKWDPRPDFKLGPKDVEGKLTWLGSKVWRYPEVRVEEVPEPKIEKPTEIIIKV
KACGICGSDVHMAQTDDEGYILYPGLTGFPVTLGHEFSGVVVEAGPEAINRRTNRRFEIG
EPVCVEEMLWCGHCRPCAEGFPNHCENLNELGFNVDGAFAEYVKVDAKYAWSLRELEDRY
GDRLFLAGSLVEPTSVAYNAVIVRGGGIRPGDNVVILGGGPIGLAAVAILKHAGAAKVIL
SEPSETRRNLAIELGADHVIDPTKENFVEAVLDYTNGLGAKLFLEATGVPQIVWPQIEEV
IWRARGINATVVIVARADAKIPLTGEVFQVRRAQIVGSQGHSGHGTFPRVISLMASGMDM
TKIISKTVTMEEIPEYIKRLQTDKSLVKVTMVNE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcggtgaggcttcatgcaaagtgggatccaaggcctgatttcaaactggggccc
aaggatgttgaaggaaaacttacctggcttggaagcaaggtgtggagatatccggaggtg
cgagttgaagaagtcccggagccaaagatcgaaaagcccacagagatcatcatcaaagtg
aaggcctgcgggatctgtggcagtgacgttcatatggcccagaccgatgatgaaggctac
attctttaccctggtcttactggttttcccgtcactttgggccacgagttttccggagtt
gtggtggaggcaggaccggaggccatcaacagaagaacaaacagaagattcgagatcgga
gagcccgtctgtgtagaggaaatgctctggtgtggtcactgcaggccctgtgctgaaggc
ttcccaaaccactgcgaaaacctgaacgaactgggattcaacgtcgatggagctttcgca
gagtacgtgaaggtcgatgccaaatacgcctggagcctcagagaactggaggacaggtac
ggtgacagactctttcttgcaggaagtctcgtggaacccacctccgttgcttacaacgct
gtaattgtgagaggaggtggaatcaggcctggagacaacgtggtgatactcggaggaggt
cctataggacttgcagccgttgcgattttgaaacacgcaggagcagcgaaagtgatcctg
tcagagccttccgaaactagaagaaaccttgccatagagctgggagcagatcacgtgata
gatcccacaaaggagaacttcgtggaagcggtgcttgattacacgaacggtcttggagca
aagcttttcctcgaagcgacaggtgttcctcagatcgtctggccacagatagaagaggta
atctggagagcccgcggtataaacgccaccgtggtgatcgtggcaagagccgacgcgaag
atacctctcactggggaagtgtttcaggtcagaagggcacagatcgtgggatctcaggga
cactctggtcatggtaccttcccgagggtgatcagtctcatggcctccgggatggacatg
accaaaatcatctccaagaccgttaccatggaggaaatacctgagtacataaagaggctt
caaaccgacaagtccctggtgaaggttaccatggtgaacgagtga

DBGET integrated database retrieval system