KEGG   Thermotoga petrophila: Tpet_1362Help
Entry
Tpet_1362         CDS       T00525                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
tpt  Thermotoga petrophila
Pathway
tpt00564  Glycerophospholipid metabolism
tpt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tpt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Tpet_1362
Enzymes [BR:tpt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Tpet_1362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD Pyr_redox_2 NAD_binding_8 Trp_halogenase Pyr_redox TrkA_N FAD_oxidored Pyr_redox_3 HI0933_like Lycopene_cycl FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ABQ47376
UniProt: A5IMF3
LinkDB All DBs
Position
complement(1351730..1353169)
Genome map
AA seq 479 aa AA seqDB search
MKAVVIGGGVFGSLIARELTKYDLEVTLIEKNLDVGWGVTKANSAIVHAGYDDPPESVRA
QFCASGNAMYEDLSKELDFDFKRIGSFVVAFNDEELKELERLLKQGEENGVPGLTILERD
EVLSMEPNLNPEVKYALYAPTAGITEPWMVAIAAVENAVQNGLKLVLGESVVGFEKVNGR
VRKIHTSKGEYEADIVINCAGLHADEIAKLAGAEYVPLHPRKGEYILLDKKLQGLVKRVI
FPTPTKVSKGILVLPTVDGGILLGPTAEDLPEEMKDRPITTREGLEKVREFTKKLVPSLD
FSLVVKTFSGLRPESPQKDFFIKVSETVKNFVNVMATRSPGLTAAPAVAKYVVEELIQEK
MRIPLEKKKDFKPERKRIVHYSELPLEEWRREIERDPRAGRLVCFCNEVTEKEIVEAIRR
GARTLDGIKFRTRAMFGRCQGGFCMARILKILERELGVDMSEIRMKSENSWVVNGKVRE
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgtcgtcataggtggcggagtgtttggttctctgatagcgcgagagttaacg
aagtacgatctggaagtgactctcatagagaagaacttggatgtaggctggggagtaaca
aaggcgaattcagccatcgttcacgctggttacgacgatccacctgaaagcgttcgtgca
cagttttgcgcgtcaggcaatgcaatgtacgaagacctctcgaaagagctggattttgat
ttcaaaagaattggatctttcgtagtggcgttcaacgatgaagaactgaaggaactcgaa
cgtctcctaaaacagggcgaagaaaacggcgttccaggtttgaccatcctggaaagagac
gaagttctttccatggagccgaatctgaacccagaggtcaaatatgccctctacgctccc
actgctggcatcacagaaccctggatggttgccatagcagccgtggaaaacgccgtccag
aacggattgaaactcgttcttggagaaagcgtcgttggctttgagaaagtcaacggtcga
gtgaggaagattcacaccagcaaaggcgaatacgaagcggatatcgtgataaactgcgct
gggctccacgcagacgagatagcgaagttagccggtgcagagtacgttcccctgcatccg
agaaaaggcgaatacattctccttgataagaaacttcagggtctggtaaaaagggtcata
ttccccacacccactaaggtctcgaaagggatactcgttcttcccacagtcgatggtgga
atccttctgggaccaactgccgaggaccttcccgaagagatgaaggacagacccataacc
accagagaaggtctcgaaaaagttcgagaattcacaaaaaaactcgtaccttccctcgat
ttctccctcgtggtgaaaaccttctcagggctgagaccggaaagtccacaaaaagacttc
ttcataaaagtgagcgagacggtgaagaacttcgtgaacgttatggcaacaagatctcct
ggtctcacagcagcgccggcggtggcaaagtacgttgttgaagagttgatccaggaaaaa
atgagaattcctcttgagaagaaaaaagacttcaaaccagaaagaaagagaatcgttcac
tattcggaacttcctcttgaagagtggagaagggaaatagaaagagatccacgtgcggga
agactcgtttgcttctgcaacgaagtgacagagaaggaaattgtcgaggcgataagaaga
ggggcgaggacccttgatgggatcaagttcagaacaagagcgatgtttgggaggtgtcag
gggggcttctgcatggctcgaattctcaagattctggagagagaactcggtgtggatatg
tcggaaataagaatgaaatcggagaacagctgggttgtgaacgggaaggtgagagaatga

DBGET integrated database retrieval system