KEGG   Theileria parva: TP03_0230Help
Entry
TP03_0230         CDS       T00254                                 

Definition
(RefSeq) succinate dehydrogenase flavoprotein subunit
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
tpv  Theileria parva
Pathway
tpv00020  Citrate cycle (TCA cycle)
tpv00190  Oxidative phosphorylation
tpv01100  Metabolic pathways
tpv01110  Biosynthesis of secondary metabolites
tpv01130  Biosynthesis of antibiotics
tpv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tpv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TP03_0230
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    TP03_0230
Enzymes [BR:tpv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     TP03_0230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 FAD_binding_3 Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 3500162
NCBI-ProteinID: XP_763248
UniProt: Q4N0B9
LinkDB All DBs
Position
3
AA seq 658 aa AA seqDB search
MFRINKILNFTPKYFSTTTKFGFKVVTHDYDAIVVGAGGAGLRSALELSILGHKTACISK
LFPTRSHTVAAQGGINAALGNMTEDDWRWHFYDTVKGSDWLGDQDSIYHMCKSAPEAVIE
LENFGVPFSRTEDGKIYQRAFGGQSLNFGKGGQAYRCAAVADRTGHSLLHTMYSTCLKYN
CSFFIEYFLLDLIKHPTENRVIGGIFLRMSNMELHVFRSNHVVIATGGFGRCYFSCTSAH
MCTGDGNAAVSRLGLPNQDMEFVQFHPTGIYPAGCLITEGCRGEGGILRNSEGEAFMARY
APVAKDLASRDVVSRSMTIEINEGRGCGPNKDHLYLDLTHLSEDVFREKLPGITETSKIF
AGVDASKEYIPVLPTVHYNMGGVPTNYKTEVVTTSPTGSGSSGVTAGNFLGDKVKGGKKK
KMTVPKPTNSGDTVVYGLYSAGESACASVHGANRLGANSLLDIIVFGKMSGTTINHKIQS
DNSNKSNLPDPTLYKDAIEKASNKLHNLLSNTTNSHSVSSANVVKPSELRLEMQKSMQKY
VSVFRNGDSLTEGRERIKELANQFQYVRISDSSKVFNTDLLEALELENLLQLSLQTVTGA
EARKESRGAHSREDFPKRDDENYRKHTLTFLHNPSQRKLRSSVTELGHTAPAPTRTYL
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgttccgaattaataaaattttaaattttacaccaaaatatttttcaaccactactaaa
ttcggatttaaggtggtaacccatgattatgatgcgatcgttgtgggagctggtggcgct
ggtttgagatcagcacttgagttgtcgattttaggacataaaacagcttgtatttcaaag
ttatttccaacccgttcacatacagttgcggctcagggtggtatcaatgccgccctgggt
aacatgactgaagatgactggcgttggcacttttatgatacagtcaagggttcagactgg
ctgggtgatcaggacagcatttaccacatgtgtaaaagtgcacctgaggctgtgattgaa
cttgagaactttggtgtcccattttctagaactgaagatggaaaaatatatcagagagcg
tttggaggccagagtcttaattttggcaaaggtggtcaggcctacagatgtgcagctgtg
gctgatagaactggacactcactactccacacaatgtactccacctgcctcaaatacaat
tgctcattcttcatcgaatatttcctactcgatctcatcaaacatcccactgaaaatcgg
gtgattggcggtatatttctgagaatgagtaatatggaattacatgtgtttaggagtaat
catgtggtaattgctactggaggatttggtagatgttacttcagttgtacatcagctcac
atgtgtacgggtgatggtaacgcagctgtgagtagactcgggttaccaaaccaggacatg
gaatttgtccaattccatcctacgggaatataccccgcaggatgtttaattactgaaggc
tgtagaggcgagggtgggattttacgtaactctgaaggtgaggctttcatggcaagatac
gccccagtagccaaagacttggcctcgagggatgtcgttagcagatccatgaccatagaa
ataaatgaaggacgtggttgcgggccaaataaagatcatctctacttagatttaacacat
ttaagtgaggatgtttttagagaaaagttgccagggattacagagaccagcaagatcttt
gcaggagttgatgcttccaaagagtatatcccagtacttccaactgttcactataatatg
ggcggagtgcccaccaactataaaactgaagttgtcaccaccagtcccacgggtagtggg
tcaagtggtgttactgctggtaacttcttaggtgacaaagttaagggtggtaagaagaag
aaaatgacagtaccgaaacccaccaactctggggataccgtggtctatgggttgtatagt
gctggtgagagcgcatgtgcaagtgtacatggtgctaatagattaggtgcgaattcatta
ttggacattatcgtctttgggaaaatgtccggaaccacaattaatcacaagattcagtct
gataatagtaataaatcaaatttgcctgatcctacactctataaagatgccattgaaaaa
gcttccaacaaactacacaatcttctgtctaacacaactaactctcactcagtaagctca
gccaatgtggtgaagcctagtgagctacgtctggagatgcagaagagtatgcaaaagtat
gtaagtgtatttaggaatggtgactcattgactgagggccgagagagaataaaagagttg
gctaatcaattccaatatgtgagaataagtgactcgagtaaagtgtttaatacagattta
cttgaggcgcttgagcttgagaatttgttacagttgagcttacaaaccgtcactggtgct
gaagccaggaaagaatccagaggtgcacactcacgcgaagacttccccaaacgtgatgat
gagaattataggaaacatactctcacttttctgcacaatccttcacaacgtaagttacgg
agctccgttacggagcttggtcacaccgcaccagcccctacaaggacttacttatag

DBGET integrated database retrieval system