KEGG   Turneriella parva: Turpa_2947Help
Entry
Turpa_2947        CDS       T02157                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
tpx  Turneriella parva
Pathway
tpx00970  Aminoacyl-tRNA biosynthesis
tpx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpx00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Turpa_2947
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:tpx03029]
    Turpa_2947
Enzymes [BR:tpx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Turpa_2947
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Turpa_2947
Mitochondrial biogenesis [BR:tpx03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Turpa_2947
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AFM13586
UniProt: I4B8H9
LinkDB All DBs
Position
3079345..3080778
Genome map
AA seq 477 aa AA seqDB search
MKFIPTIGLEVHCQLNTRSKLFSTAATSFGADANTEVQTVCLGLPGALPVLNYEAVRKAV
KAGLALGGVIHERSKFDRKNYFYPDLPKGYQISQFFEPYCTKAAIDIEIESGKKRIGITR
IHIEEDAGKLMHSEDPLVHESYVDLNRAGTPLIEIVSEPEIDNSDEAVLYLTELKKILEY
IDVSDCNMEQGSLRVDANVSIRPEGSDKLGTRVEIKNLNSFKAVKAAIEYEIRRHTEVIE
SGGKIVQETRLYNAVRDTTQSMRSKEEAHDYRYFPDPDLVPLILKPADIEEIRKDLPELA
HQKRARYVAEFGLPEYDAGVLTADRSTALYYEDVIRAGAPAKKASNWVMVEMLAIVKEKN
KALTELFPPTNLAELIQLIDSGVISGKIAKEVFADMIATGKKPKAIVDEKGMSQISDEGA
IREIVLAVMGEHPASVADFKAGKDRALKHLQGEIMKKTRGKVNPQVANKLLEEELKK
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcattcccacgattggtcttgaggtacactgccagctcaacacccgcagcaaa
cttttttcgaccgctgccacctctttcggcgccgatgccaatactgaagtgcagactgtc
tgcctcgggcttcccggcgcattacccgttctcaattacgaagcggtacgaaaagctgtc
aaagccggccttgcattggggggagtgattcacgaacgcagtaaatttgaccgtaaaaac
tatttttacccagacttaccgaagggctatcagatttcgcagttctttgagccctattgc
accaaagcggcgatcgacattgaaatcgagtcgggcaaaaagcgcatcggtatcacgcgc
attcacatcgaagaagacgcgggcaagctcatgcactcagaagatccgctggtgcacgaa
agttatgtcgacctcaaccgtgcgggcaccccgctcatcgaaattgtttcagagccagag
atcgacaattcagatgaagcagtgctctatctcacagaactcaagaaaattctcgaatac
atcgacgtctctgactgcaacatggagcagggctcgctgcgtgtcgatgcaaacgtgagc
attcgccccgaaggctcagacaaactcggcacacgcgttgaaatcaaaaacctgaactct
ttcaaagcggtcaaagcagcgattgaatacgaaatccgccggcataccgaagtcatcgaa
tcgggcggtaagatcgtgcaagagacgcgcctctataatgccgtgcgcgatacgacgcag
tcgatgcgcagcaaagaagaggctcatgactaccggtattttcccgaccccgacctcgtg
ccgctgattctgaaacctgcagacatcgaagagattcgtaaagacctgccagaactcgcg
caccagaaacgcgcgcgctatgtcgccgaatttggtttacctgaatatgacgcgggtgtg
ctgactgccgaccgcagcacagcgctctactatgaagatgtcattcgcgcaggcgccccg
gcgaaaaaggcttcaaactgggtgatggtcgagatgcttgcgattgttaaagaaaagaac
aaggcgctgacagaactgtttccccccacgaacctagccgagctgattcagctgattgac
tcaggcgtcatttcgggtaagatcgccaaagaggtcttcgccgacatgattgccaccggc
aagaagccgaaagcgatcgtcgacgagaagggcatgtcgcagattagcgacgagggtgca
attcgcgaaatcgtgctcgcggtcatgggcgaacaccccgcgtcggttgccgactttaag
gcgggcaaagaccgcgcgctcaagcacctgcagggcgaaattatgaaaaagacgcgcggt
aaggtgaacccgcaggtggcgaacaagctgctcgaagaagaactaaaaaagtag

DBGET integrated database retrieval system