KEGG   Trueperella pyogenes TP6375: CQ11_04250Help
Entry
CQ11_04250        CDS       T03070                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tpy  Trueperella pyogenes TP6375
Pathway
tpy00010  Glycolysis / Gluconeogenesis
tpy00030  Pentose phosphate pathway
tpy00051  Fructose and mannose metabolism
tpy00052  Galactose metabolism
tpy00680  Methane metabolism
tpy01100  Metabolic pathways
tpy01110  Biosynthesis of secondary metabolites
tpy01120  Microbial metabolism in diverse environments
tpy01130  Biosynthesis of antibiotics
tpy01200  Carbon metabolism
tpy01230  Biosynthesis of amino acids
tpy03018  RNA degradation
Module
tpy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tpy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CQ11_04250
   00030 Pentose phosphate pathway
    CQ11_04250
   00051 Fructose and mannose metabolism
    CQ11_04250
   00052 Galactose metabolism
    CQ11_04250
  09102 Energy metabolism
   00680 Methane metabolism
    CQ11_04250
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    CQ11_04250
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tpy01009]
    CQ11_04250
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:tpy03019]
    CQ11_04250
Enzymes [BR:tpy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CQ11_04250
Protein phosphatases and associated proteins [BR:tpy01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CQ11_04250
Messenger RNA biogenesis [BR:tpy03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CQ11_04250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AHU89323
UniProt: X4QU41
LinkDB All DBs
Position
893310..895580
Genome map
AA seq 756 aa AA seqDB search
MDNVDSPEVKIGILTSGGDAQGMNATVRSVVRTALQLGAEPYAFLEGWRGPVEGGALIKK
MGWSDVSSTINKGGTAIGTARCAEFRERSGMKKAVYNFVSNGIDRLVIMGGDGTLTGADE
LRQLWPELLAELVTEGKISPEDGERHAKLMIAGIVGSIDNDLVGTDMTVGADSALTRIIE
AIDAIAATAASHQRTFIIEVMGRRCGYLALMSAIAGGCDYVFIPELPPADGWEDQLAEKL
RLGRENGRRDSLIVVAEGATDRHGNPITAEQVRAAIKERLGEDPRITSLGHVQRGGAPSA
YDRWMPTLLGYTAAWDMVHATQDSEPVIIGTRRNKLVRLPMMEAIQNTRAVKNYLAEGDW
ENAVASRGNHYREMIDLFSTLSSPIGPERPEHSKRIGIVHAGGLAPGMNPAARAAVKLGI
DRGYTMLGIEGGFPGLLDGQIRELKWNDVEGWAEDGGAELGTRRTIPDLDQYYALGRAIE
NAELDGLIVIGGFKAYKMVYEMHKESARYPAFKIPMVLVPASIDNNLPGAEFSIGADTTL
NWNTQTIDRIRQSASASRRCFVVETMGRKCGYLALMSALTTGAEQVYLYEDGVTLSQLAA
DTAKMIRSFEAGRRLYLVIRNEDASEYYNADVLANIFEEEGSNLFDVRSVILGHAQQGGN
PSPFDRTLAVRLVNSAMNALAADFEGGKHSSFHVGMVDGDIEIQPVAHMDELIDMEDRLP
YEPWWHLLKDVLYVVSDPTARLELTQLPIVIDAHQS
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
gtggacaacgtggatagcccggaagtgaaaatcggtattctgacctcaggcggtgatgcc
cagggcatgaatgcaaccgtccgctcggtagttcgcactgcgctccagctcggagccgag
ccgtatgcattcctcgagggctggcgcggcccggtcgaaggtggggctctcatcaagaag
atgggctggtcggacgtctcctccacgatcaacaagggcggcaccgccattggcaccgcg
cgctgtgctgaattccgcgaacgttccgggatgaagaaagccgtctacaatttcgtgtcg
aacggcatcgaccgcctcgtcattatgggcggagacggcacgctcaccggcgcggacgaa
ttgcgccagctgtggcccgaactgctggccgagctggtcaccgagggcaagatctccccc
gaagacggcgaacgccacgcgaagctaatgatcgccggcatcgtgggctccatcgataac
gacttggtgggtaccgacatgacagtcggcgcagactccgccctgacccgcatcattgaa
gcgatcgatgctatcgcggccaccgccgcctcccaccagcgcacttttattatcgaggtc
atgggccgacgctgcggctacctcgccctcatgtccgccatcgccggtggttgtgactac
gtcttcatcccagagctgcctccggccgacggctgggaggatcaactcgccgagaagctg
cgtttaggccgggagaatgggcggcgtgactcgctcatcgtcgtcgccgaaggggctacc
gaccgccacggaaatccgatcaccgccgagcaggtgcgcgccgctatcaaggagcgccta
ggcgaggacccgcgcatcacatcgctcggacacgtccagcgcggtggcgcgccctccgcc
tacgaccggtggatgcccacgctcctgggctacaccgcggcatgggatatggttcacgcc
acccaggatagtgagccggtcatcattggcacgcgccgcaacaagctagttcgcctgccc
atgatggaggccatccagaacacccgcgcggtgaagaactaccttgccgagggcgactgg
gagaacgccgtcgcctcgcgtggcaaccactaccgcgaaatgattgacctcttctccacg
ctctcctcgcccatcggtcccgagcgcccggagcattccaagcggatcggcatcgttcat
gccggtgggctcgcccccggtatgaatcccgcagcccgcgccgccgtcaaactcggcatc
gaccgtggctataccatgctcggcattgagggcggcttccccggtctgctcgacgggcag
atccgcgagctcaagtggaacgacgtcgagggctgggctgaagacggcggcgccgaactc
ggcacccgccgcacgatccccgatcttgaccagtactacgccctcggccgcgcaatcgag
aacgccgagctagacggcctcatcgttattggtggtttcaaggcctacaagatggtctac
gagatgcacaaggaatcggctcgctatcccgctttcaagatcccgatggttctggtgccg
gcgtcgattgacaacaatttgcccggcgcggagttttccataggtgcggacaccaccctg
aactggaacacgcagactatcgatcggatacggcagtcggcgtcggcgtcgcggcgttgc
tttgtggtggaaacgatggggcgcaagtgtggctatctggccctcatgtcggcgctgacg
acgggcgccgagcaggtctatctgtacgaagacggcgtcacactcagccagctcgccgcc
gacaccgcgaagatgatccgctcctttgaagccggccgtcgcctgtacctggtgattcgc
aacgaggacgcctccgagtattacaacgccgacgtgctggccaatatcttcgaagaagaa
ggatcgaacctgttcgatgtccgctcggtcatcctgggccacgcccagcagggcggcaac
ccctcaccgttcgatcgtacgctcgccgtgcgcctggtcaacagtgcgatgaatgcgttg
gcggcggattttgagggcggcaagcacagttctttccatgtgggcatggtcgatggggac
atcgagatccagcccgtggcgcacatggacgagctgatcgacatggaagatcgcctgccc
tacgagccgtggtggcatctgctcaaggacgtgctctacgtggtttcagatccgacggca
aggttggagctcacccagcttccgatcgtcatcgacgcccaccaatcctag

DBGET integrated database retrieval system