KEGG   Trueperella pyogenes TP6375: CQ11_09085Help
Entry
CQ11_09085        CDS       T03070                                 

Definition
(GenBank) ribulose 5-phosphate epimerase
  KO
K03077  L-ribulose-5-phosphate 4-epimerase [EC:5.1.3.4]
Organism
tpy  Trueperella pyogenes TP6375
Pathway
tpy00040  Pentose and glucuronate interconversions
tpy01100  Metabolic pathways
tpy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tpy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CQ11_09085
   00053 Ascorbate and aldarate metabolism
    CQ11_09085
Enzymes [BR:tpy01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.4  L-ribulose-5-phosphate 4-epimerase
     CQ11_09085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AHU90076
UniProt: X4R003
LinkDB All DBs
Position
1937376..1938086
Genome map
AA seq 236 aa AA seqDB search
MKLTDLPAHVQENVAVARREVCDLHAELPAGGLVVWTAGNVSQRVAGAELFVIKPSGVRY
AELTPETMVVCTLDGDKIEDGTPAELTPSSDTAAHAYVYRHMPEVGGVVHTHSPYACAFA
AVHRPIPCVLTMMADEFGGEVPVGPFAIIGDDSIGRGIVDTLAGSRSPAVLMGNHGPFTV
GKDATAAVKAAVMVEEVAKTVAIAEGLGQPQPIAEEHVDKLHDRYQNVYGQIQERN
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcaccgatcttcctgcccacgtgcaggaaaacgtggcggtagctcggcgcgaa
gtgtgcgaccttcacgccgagctaccggccggcggcctggtggtctggacggcaggcaac
gtctctcagcgtgtggcgggtgcggagctgttcgtcatcaagccttctggcgtgcgttat
gcggaactgaccccagagaccatggtggtgtgcacgctggatggggacaagatcgaggac
gggacgccagctgagctcacgccgtcgtcagatactgcggctcacgcatacgtctatcgc
cacatgcctgaggtcgggggagtggtccatacgcactcgccgtacgcctgcgcctttgcc
gccgtgcaccggccaatcccgtgtgtgctcacgatgatggctgacgaattcgggggcgag
gtgcccgtgggcccgttcgccatcatcggcgacgactcgatcggccgcggcatcgtggac
accctagcggggtcacgttcgcctgcggtactcatgggcaatcatggcccattcacggtg
ggcaaggacgctaccgcagctgtcaaggctgccgtcatggtggaggaagtggccaagacc
gtggcgatcgcggagggccttggccagccgcagcctattgccgaagaacatgtggacaaa
ctccacgaccgttaccagaacgtctacggacagatccaggagaggaactga

DBGET integrated database retrieval system