KEGG   Trueperella pyogenes TP8: X956_03220Help
Entry
X956_03220        CDS       T03579                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
tpyo  Trueperella pyogenes TP8
Pathway
tpyo00473  D-Alanine metabolism
tpyo01100  Metabolic pathways
tpyo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:tpyo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    X956_03220
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    X956_03220
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tpyo01011]
    X956_03220
Enzymes [BR:tpyo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     X956_03220
Peptidoglycan biosynthesis and degradation proteins [BR:tpyo01011]
 Precursor biosynthesis
  Racemase
   X956_03220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AJC69238
LinkDB All DBs
Position
686312..687412
Genome map
AA seq 366 aa AA seqDB search
MTDFPSRALISHSAFVHNLRRVRSTTSAEVMAIVKGNAYGHGLERIARWAWEEGVRWFGV
AQLAEALELRSYLPQARILTWIYAPSTDLTEAFAADLDLSIGAVWALDALAHARHAKVHI
KVDTGMARGGFTMCELRSHAERIAQLEREGCIDVVGLWSHLARADEPDSAETARQVKRFE
EAAGVLAQVGVIPERLHLAASAGTLWHPATHYDMVRPGIALYGLSPDPAVQTAAELGLRA
VMQLEADIMTTREVPADTGISYNHTYTTPEPTRLAVVPLGYADGIARSASNAMAVTVNGV
RCPIRGKVCMDQFVVEGQVCPGDVAVLFGDAAAGFTTADDWAGATATIGYEIVTRIGSHV
PRLDAP
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgactgattttccttctcgcgcccttatctcgcactcggctttcgtccacaatctccgt
cgcgtcaggtcgacgacgtcggccgaggtcatggccattgtcaagggcaacgcctacggg
cacgggttggagcgcatcgcacgctgggcgtgggaggagggcgtgcgctggttcggcgtc
gcgcaactggcggaggccctcgaactgcgctcttatcttccccaagcgcggatcctcacg
tggatatacgcccccagtaccgatctgaccgaggcgttcgccgcggatctcgacctgtcg
atcggcgcggtatgggcactcgacgcgctcgcgcacgcgcgccacgccaaggtccacatt
aaggtcgatactggcatggctcgcggtggatttaccatgtgtgagctgcgcagccatgcc
gaacgcatcgcgcagctggagcgagagggctgcatcgacgtcgttggcctgtggtcccac
ctcgctcgtgcggatgagccggatagcgcagaaacagcgcgacaggtgaagcgcttcgag
gaggccgctggggtgcttgcgcaagtcggggtgatcccggagcgcttgcatttggcggca
tccgcgggaacgctctggcacccggctactcactacgacatggtccgtcccggcatcgcg
ctctacgggttgagcccagatccagccgtgcagaccgctgctgagctcgggttacgggct
gtcatgcagctcgaggccgacatcatgaccacccgagaggtgccagccgacaccgggatc
tcctacaaccacacgtatacgacgccggagccgacccgcctggccgtggtgccgctcggc
tacgcggacgggatcgcccgatcggcctcgaatgcgatggctgtgacggtcaacggcgtg
cgctgcccgattaggggaaaggtctgcatggaccaattcgtcgtggagggacaggtatgc
ccgggggatgtcgccgtcctcttcggcgacgccgcagcaggatttacaactgccgacgac
tgggcgggtgcgacggcgacgatcggttacgaaatcgtcacccgtattggatcccacgtc
cctcgcctagacgcgccctag

DBGET integrated database retrieval system