KEGG   Trueperella pyogenes TP8: X956_03540Help
Entry
X956_03540        CDS       T03579                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tpyo  Trueperella pyogenes TP8
Pathway
tpyo00010  Glycolysis / Gluconeogenesis
tpyo00030  Pentose phosphate pathway
tpyo00051  Fructose and mannose metabolism
tpyo00052  Galactose metabolism
tpyo00680  Methane metabolism
tpyo01100  Metabolic pathways
tpyo01110  Biosynthesis of secondary metabolites
tpyo01120  Microbial metabolism in diverse environments
tpyo01130  Biosynthesis of antibiotics
tpyo01200  Carbon metabolism
tpyo01230  Biosynthesis of amino acids
tpyo03018  RNA degradation
Module
tpyo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tpyo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    X956_03540
   00030 Pentose phosphate pathway
    X956_03540
   00051 Fructose and mannose metabolism
    X956_03540
   00052 Galactose metabolism
    X956_03540
  09102 Energy metabolism
   00680 Methane metabolism
    X956_03540
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    X956_03540
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tpyo01009]
    X956_03540
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:tpyo03019]
    X956_03540
Enzymes [BR:tpyo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     X956_03540
Protein phosphatases and associated proteins [BR:tpyo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     X956_03540
Messenger RNA biogenesis [BR:tpyo03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     X956_03540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AJC69286
LinkDB All DBs
Position
complement(747221..749491)
Genome map
AA seq 756 aa AA seqDB search
MDNVDSPEVKIGILTSGGDAQGMNATVRSVVRTALQLGAEPYAFLEGWRGPVEGGALIKK
MGWSDVSSTINKGGTAIGTARCAEFRERSGMKKAVYNFVSNGIDRLVIMGGDGTLTGADE
LRQLWPELLAELVNEGKVSPEDGERHAKLMIAGIVGSIDNDLVGTDMTVGADSALTRIIE
AIDAIAATAASHQRTFIIEVMGRRCGYLALMSAIAGGCDYVFIPELPPADGWEDQLAEKL
RLGRENGRRDSLIVVAEGATDRHGNPITAEQVRAAIKERLGEDPRITSLGHVQRGGAPSA
YDRWMPTLLGYTAAWDMVHATQDTEPVIIGTRRNKLVRLPMMEAIQNTRAVKNYLAEGDW
ENAVASRGNHYREMIDLFSTLSSPIGPERPEHSKRIGIVHAGGLAPGMNPAARAAVKLGI
DRGYTMLGIEGGFPGLLDGQIRELKWNDVEGWAEDGGAELGTRRTIPDLDQYYALGRAIE
NAELDGLIVIGGFKAYKMVYEMHKESARYPAFKIPMVLVPASIDNNLPGAEFSIGADTTL
NWNTQTIDRIRQSASASRRCFVVETMGRKCGYLALMSALTTGAEQVYLYEDGVTLSQLAA
DTAKMIRSFEAGRRLYLVIRNEDASEYYNADVLANIFEEEGSNLFDVRSVILGHAQQGGN
PSPFDRTLAVRLVNSAMKALAADFEGGKHSSFHVGMVDGDIEIQPVAHMDELIDMEDRLP
YEPWWHLLKDVLYVVSDPTAKLELAQLPIVIDAHQS
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
gtggacaacgtggatagcccggaagtgaaaatcggtattctgacctcaggcggtgatgcc
cagggcatgaatgcaaccgtccgctcggtagttcgcactgcgctccagctcggagccgag
ccgtatgcattcctcgagggctggcgcggcccggtcgaaggtggggctctcatcaagaag
atgggctggtcggacgtctcctccacgatcaacaagggcggcaccgccattggcaccgcg
cgctgtgctgaattccgcgaacgttccgggatgaagaaagccgtctacaatttcgtgtcg
aacggcatcgaccgcctcgtcattatgggcggagacggcacgctcaccggcgcggacgaa
ttgcgccagctgtggcccgaactgctggccgagctggtcaacgagggcaaggtctccccc
gaagacggcgaacgccacgcgaagctaatgatcgccggcatcgtgggctccatcgataac
gacttggtgggtaccgacatgacagtcggcgcagactccgccctgacccgcatcattgaa
gcgatcgatgctatcgcggccaccgccgcctcccaccagcgcacttttattatcgaggtc
atgggccgacgctgcggctacctcgccctcatgtccgccatcgccggtggttgtgactac
gtcttcatcccagagctgcctccggccgacggctgggaggatcaactcgccgagaagctg
cgtttaggccgggagaatgggcggcgtgactcgctcatcgtcgtcgccgaaggggctacc
gaccgccacggaaatccgatcaccgccgagcaggtgcgcgccgctatcaaggagcgccta
ggcgaggacccgcgcatcacatcactcggacacgtccagcgcggtggcgcaccctccgcc
tacgaccggtggatgcccacgctcctgggctacaccgcggcatgggatatggttcacgcc
acccaggatactgagccggtcatcattggcacgcgccgcaacaagctagttcgcctgccc
atgatggaggccatccagaacacccgcgcggtgaagaactaccttgccgagggcgactgg
gagaacgccgtcgcctcgcgtggcaaccactaccgcgagatgattgacctcttctccacg
ctctcctcgcccatcggccccgagcgcccggagcattccaagaggatcggcatcgttcat
gccggtgggctcgcccccggcatgaatcccgcagcccgcgccgccgtcaaactcggcatc
gaccgtggctataccatgctcggcatcgagggcggcttccccggtctgctcgacgggcag
atccgcgagctcaagtggaacgacgtcgagggctgggctgaagacggcggcgccgaactc
ggcacccgccgcacgatccccgatcttgaccagtactacgccctcggccgcgcaatcgag
aacgccgagctagacggcctcatcgttattggtggtttcaaggcctacaagatggtctac
gagatgcacaaggaatcggcgcgctatcccgccttcaagatcccgatggttctggtgccg
gcgtcgattgacaacaatttgcccggcgcggagttttccataggtgcggacactaccctg
aactggaatacgcagacaatcgatcggatacggcagtcggcgtcggcgtcgcggcgttgc
tttgtggtggagacgatggggcgcaagtgtggctatctggccctcatgtcggcgctgacg
acgggcgcagaacaggtctatctgtacgaagacggcgtcacgctcagccagctcgccgcc
gacaccgcaaagatgatccgctcctttgaagctggccgtcgcctgtacctggtgattcgc
aacgaggacgcctccgagtattacaacgccgacgtgctggccaatatcttcgaagaagaa
ggatcgaacttgttcgatgtccgctcggtcatcctgggccacgcccagcagggcggcaac
ccctcaccgttcgatcgcacactcgccgtgcgcctggtcaacagcgcgatgaaagcgttg
gcggcggattttgagggcggcaagcacagttctttccatgtgggcatggtcgatggggac
atcgagatccaacccgtggcgcacatggacgagctgatcgacatggaagatcgcctgccc
tacgagccgtggtggcatctgctcaaggacgtgctctacgtggtttcagatccgacggca
aagttggagctcgcccagcttccgatcgtcatcgacgcccaccaatcctag

DBGET integrated database retrieval system