KEGG   Trueperella pyogenes TP8: X956_09105Help
Entry
X956_09105        CDS       T03579                                 

Definition
(GenBank) dihydroxyacetone kinase
  KO
K20901  L-erythrulose 1-kinase [EC:2.7.1.209]
Organism
tpyo  Trueperella pyogenes TP8
Brite
KEGG Orthology (KO) [BR:tpyo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    X956_09105
Enzymes [BR:tpyo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.209  L-erythrulose 1-kinase
     X956_09105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dak1 Dak2 DmpG_comm
Motif
Other DBs
NCBI-ProteinID: AJC70134
LinkDB All DBs
Position
complement(1964865..1966571)
Genome map
AA seq 568 aa AA seqDB search
MTFLVNDPEKFPAEAVAGFAAAYSTYVQPVHGGVVRAGASPQGEVSIVVGGGSGHYPAFA
GWVGEGMAHGAVCGNIFSSPSASQATAVCRAADNGGGTLIMFGNYAGDVLHFGNAAEQLR
AEGKDVRIFTISDDIASNTPENHLDRRGIAGDLLVVKVAGAASAAAMTIDDVEALATRAN
ERTRTLGVAFTGCTFPGAQEPLFEVEPGTFGLGLGIHGEPGISEHEMMTSDEIAAMIIDK
LMEEEPNRGEGEHPYDGRVAVLVNGLGATKYEEMFVFYGAVKRLLEARGLTIVGPVVDEQ
VTSLDMAGISLSLMFLDDELEQLWLAPANTPAYRVGNVTTTTKKRVVVEDAAEEIRAGSP
ESAKLAKVVARVLEAFEVKAREVEHELGRMDAVAGDGDHGQGMVLGATAAAKAAREAVEA
GAGARTLLVRAGAAWSEGAGGTAGALWGGALAKVGAGLSDEEAADEADVLNAVVDGARSF
VTMGGAQVGDKTIVDASEVFAAALEVGDGTFADVWGAAARAAEEAAAGTANFVAKKGRAR
THGNKSVGTPDPGATSFAMLMTVVPEAI
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgacgtttttggttaacgatcccgaaaagttccccgccgaagccgtggcaggcttcgcg
gccgcctattcgacttatgttcagcctgtacacggcggcgtcgtgcgtgctggggcatcc
ccgcagggtgaggtgtcgatcgtcgtcggcggcggctcgggccactatcccgcgtttgcc
ggctgggtgggcgaaggcatggcccacggcgccgtgtgcggcaacatcttctcttcgccg
tcggcctcacaggcgacggcggtgtgccgagcggcggacaacggcggtggcacgctcatc
atgttcggcaactacgccggcgacgtcctccacttcggcaacgcggccgagcagctgcga
gcggaaggcaaggacgtgcgcatcttcaccatctccgacgacatcgcctccaacacgccc
gagaatcatctcgaccgccgcggcatcgccggtgacctcctcgtggtcaaagtggctggc
gctgcctccgccgcggctatgacgatcgacgacgtcgaggcgctcgccacccgcgccaac
gagcgcacccgtaccctcggcgtcgcgttcacagggtgtacgtttcccggcgcgcaggag
ccgttgttcgaggtcgagcccggcacgttcggcctgggtctgggcatccacggcgagccg
ggaatctccgagcacgagatgatgacgtccgacgagatagcggcgatgatcatcgacaag
ctcatggaagaggaaccgaaccgtggcgagggtgagcatccctacgacggccgcgtggcc
gtgctggtcaacggcctgggcgccacgaaatatgaggaaatgttcgtcttctacggcgcg
gtcaagcgcctgctggaggcgcgcggcctgaccatcgtgggtccggttgtcgatgagcag
gtcacctcgctcgacatggccgggatctcgctgtccctcatgttcctcgacgacgagctc
gagcagctctggctcgctcccgccaacacgcctgcctaccgggtgggtaacgtgacgacg
acgaccaaaaaacgcgtagtcgtggaggacgcggcggaggaaatccgtgcaggctcaccg
gagtcggcgaaactggccaaagtagtggcgcgcgtactggaagccttcgaggtcaaggcg
cgcgaggtcgaacacgagctcgggcgcatggacgcggtggccggcgacggcgaccacggc
cagggcatggtcctgggcgcgaccgcggccgcgaaagccgcccgcgaggccgtcgaagct
ggagccggggcgcgcacgctcctcgtccgcgcgggagccgcctggtccgagggcgctggt
ggtaccgccggtgcactgtggggaggcgcactcgccaaggtcggcgccggcctatccgat
gaagaagctgctgatgaagcggacgtgttgaacgccgtcgtggacggagctcgatcgttt
gtcacgatgggcggagcccaggtaggcgacaagacgatcgtcgatgcctcggaggtattc
gcagccgcgctcgaggtaggcgacggcacgttcgcggacgtgtggggcgccgccgctcgc
gccgccgaagaagccgccgcaggcaccgccaacttcgttgcgaagaagggacgcgcccgc
actcacggcaacaaatctgtggggacccccgatccaggcgccacctccttcgcaatgctc
atgacagtagtacccgaggccatataa

DBGET integrated database retrieval system