KEGG   Trueperella pyogenes TP8: X956_09485Help
Entry
X956_09485        CDS       T03579                                 

Definition
(GenBank) hypothetical protein
  KO
K13730  internalin A
Organism
tpyo  Trueperella pyogenes TP8
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LRR_4 FG-GAP LRR_8 VCBS LRR_9
Motif
Other DBs
NCBI-ProteinID: AJC70715
LinkDB All DBs
Position
2055269..2058037
Genome map
AA seq 922 aa AA seqDB search
MAAVAVVNTITPFAVADSNLDSAYDEILRERFGGDDDFNRGPSTPDKGRGDNSDRGKDKA
EKPAAPAPKPAAPAPKPAAPTPKRDQRQPFPAPPTEKVDQTKSPIKDSGLRSCIRLVPEQ
RIGGTGEVTAEHVANITKLSCIGSNITDLAGLEGAKNLRELDLTQTKVSDLSPLAALPNL
EVLRLDKTQVKDLSKLGAPAKLTKLYLANNGLTSLAGLKPQPKLTELSLLNNALSDITAV
SGLPALEELNITGNSITLLKPLAKLTKMRELRASKNKISDLSPLSGLKNLSILELGTNQI
SDVATLATLPNLGTLSVRDNKITDLSVLTALKKLYRLDVSNNPDSNNPALKKIAFVAAPA
GFDPNQGIGLINVGAPKTPSPSSPDASAPAPQAPSGALEHWYGQLQSATGASIAPQSCDF
TGDGKPDVVVGAWKTNNLTGMAYVIPNGTPSGDLDAQTGVTRIFGAEKAGMAGFNVNCLG
DVNGDGRADIGISNHNVNRGYVVFGAATPADIHLDNLDGRGYAITAGTADKIGTGWQIAP
MGDLNGDKLADIAVVSQGGGPAKRGEVVVLPGKKTTSDIAISDPSALLRIHGNGNSPVFS
VAKVGDMDGDGVRDIAVGGYYGTVAGALKPATGVAWIISGKARGTIDVTKKFDGFQINGP
LRGGDRLGMSFANLGDMNGDGYDDVAIGASPSKGTGSVAVVLGSSRFNAVSIDPATQFPV
SDADGARGWWITDSNAGKGLGYSIAAVPATGKRSGTLVMGDSDTARAIAIDTSALTAKNA
NGGLVDLSNVASSLKVEIDSAGDRLGRSVGVIDGFGSHAGPLMLAGADRANLVQGRGSVI
LAALPKTHAISTPDKADTPAPADTAKGSDQKADKSPATAKVQATANKGENLAFTGASVAL
LGGIGLLILGAGVLLRRLLKNS
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
gtggcggcagtggccgtggtcaacaccatcacacctttcgccgtcgctgacagcaattta
gactctgcctatgatgagatcttgagagaacgcttcgggggtgatgacgactttaaccgt
ggcccctctacaccggataagggccgcggcgataattccgaccgcggaaaggacaaggcc
gagaagcccgctgcaccggcaccgaaaccagccgcaccggcgccaaagcccgccgcaccg
acgccgaaacgcgatcagcgccagcccttccccgctcctcccacggagaaggtagaccag
acgaagtcccccatcaaagactcgggcttgcgctcgtgtatccggctggtgcctgagcag
cgcatcggtggaaccggtgaggtcacagcagagcacgtcgctaacatcacgaagctctcc
tgcatcggctccaatatcactgatctcgctggactcgagggtgcaaagaacctgcgcgag
ctagacctcacccagacgaaggtcagcgacctctcgcctctcgcagcgcttcctaacctc
gaagttttgcgcctcgataagacgcaggtcaaggatctgtccaagctcggcgctcccgcc
aagctgacgaagctttacctggccaacaacggattgacgagcctcgccgggctcaagccg
cagcccaagctcaccgagctctccttgctcaacaacgccctgagcgacatcactgcagtc
tccgggctgccggcgctggaagagctcaacatcaccggcaattccatcactttgctcaag
ccgcttgcgaagctgacgaaaatgcgcgagctgcgcgcctccaagaacaagatcagcgat
ctttcgccactttcggggctgaagaacctctccattcttgaactgggcaccaaccagatt
tccgacgtcgccactctggccacgctgcccaacctcggaacgctttcggtgcgcgacaac
aagatcaccgacttgtctgtgctaaccgcgctcaaaaagctgtaccgtctcgacgtcagc
aacaatcccgattcgaataacccagcactgaagaagatcgccttcgtggccgcacccgcg
ggcttcgaccccaaccagggaatcggactgattaacgtgggggcaccgaagacgccgtct
cccagctcccctgatgcctctgccccggcaccgcaagctccctctggagcgctcgagcat
tggtacggacagctgcagtctgcaaccggagcatcgatagcgccgcaaagctgtgacttc
acgggcgatgggaaacccgacgtcgtcgtcggcgcatggaagaccaataacctcaccggc
atggcatacgttattcccaacggaacgcccagcggtgacctcgatgcgcaaaccggcgtc
acccgcatcttcggtgcagaaaaggccggaatggcaggctttaacgtcaattgcctcggc
gacgttaacggcgacgggcgcgccgacatcggcatctcgaaccacaacgtcaaccgcgga
tacgtcgtgttcggcgccgccacgccggcagatatccacctcgacaacctagacgggcgc
ggctacgccatcacagccggcactgccgacaagatcgggaccggctggcagattgcgccg
atgggcgacctcaacggcgacaagctggccgacatcgccgtcgtctcccagggcggtggc
cccgccaagcgcggcgaagtcgtcgtcctgcccggaaagaagaccacgtcggacatcgcc
atctccgacccgagcgccttgctgcgcatccacggtaacggcaattcgcccgtcttcagc
gtcgctaaagtcggagatatggacggcgacggcgtgcgcgatatcgccgtcggcggctac
tacggcaccgtggcaggcgctctcaagcccgccaccggcgtcgcgtggatcatctccggc
aaggcccgcggcactatcgacgtcaccaagaaatttgatggcttccagatcaacggcccg
ctgcgcggcggcgaccgcctggggatgtcttttgcgaacctcggagatatgaacggtgac
ggctacgacgacgtcgccatcggcgcatcccccagcaagggcacaggctcggtcgccgtg
gtgttgggatcctcgcgcttcaacgcggtctcaatcgacccggccactcagttccccgtc
tccgacgccgatggcgcacgcggctggtggatcaccgattccaacgcgggcaagggactc
ggatactccatcgccgccgtgcctgcgaccggcaagcgcagcggcaccctggtgatgggc
gattctgacactgcccgggcgattgccatcgacacctcggcgctcaccgccaagaacgcc
aacggaggcctggtagacctctccaatgtcgcctcctcgctgaaggtggagatcgacagt
gcgggcgatcggcttggccgctcggtcggcgtcatcgacgggttcggctcccacgctggc
cccctgatgctggccggtgctgaccgcgccaacctcgtccaggggcgcggttcggtgatc
ctcgcagcgctgccgaaaacgcacgccatctccacgccggacaaggccgacactcctgct
ccggctgacacggcaaaaggctctgaccagaaggccgacaagtcgccagcaaccgcgaaa
gtgcaggccacggccaataagggcgagaatttggcgttcaccggcgccagcgttgcgctc
ctcggcggcattggtctgctaatactgggtgcgggcgtgctcctgcgccgcctcctgaag
aacagctaa

DBGET integrated database retrieval system