KEGG   Thermacetogenium phaeum: Tph_c09380Help
Entry
Tph_c09380        CDS       T02276                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase PfkA
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tpz  Thermacetogenium phaeum
Pathway
tpz00010  Glycolysis / Gluconeogenesis
tpz00030  Pentose phosphate pathway
tpz00051  Fructose and mannose metabolism
tpz00052  Galactose metabolism
tpz00680  Methane metabolism
tpz01100  Metabolic pathways
tpz01110  Biosynthesis of secondary metabolites
tpz01120  Microbial metabolism in diverse environments
tpz01130  Biosynthesis of antibiotics
tpz01200  Carbon metabolism
tpz01230  Biosynthesis of amino acids
tpz03018  RNA degradation
Module
tpz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tpz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tph_c09380 (pfkA)
   00030 Pentose phosphate pathway
    Tph_c09380 (pfkA)
   00051 Fructose and mannose metabolism
    Tph_c09380 (pfkA)
   00052 Galactose metabolism
    Tph_c09380 (pfkA)
  09102 Energy metabolism
   00680 Methane metabolism
    Tph_c09380 (pfkA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    Tph_c09380 (pfkA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:tpz01009]
    Tph_c09380 (pfkA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:tpz03019]
    Tph_c09380 (pfkA)
Enzymes [BR:tpz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Tph_c09380 (pfkA)
Protein phosphatases and associated proteins [BR:tpz01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Tph_c09380 (pfkA)
Messenger RNA biogenesis [BR:tpz03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Tph_c09380 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: AFV11167
UniProt: K4LGF9
LinkDB All DBs
Position
977947..978918
Genome map
AA seq 323 aa AA seqDB search
MKRQVNRIGMLTSGGDAPGMNAAIRAVVRKSIYHGLEVVGIKRGFDGLLKKEFVKLQLGS
VADIIHRGGTILHTARSEEFKTEEGQRKGVNNLRDGGIDGLVVIGGDGSFKGALALAKLG
VPVIGVPATIDNDVGGTDLTIGFDTAVNNVVDAINKIRDTATSHERIFIIEVMGRHAGHI
ALYAGLSGGAESILVPEIPVDIDEVIFKLQRGINRGKLHSIIIVAEGAASGLTIGEEIKK
RMGQETRVTILGHLQRGGTPTALDRMLASCMGAKAVDLLLEGESRKMVGIVNGQLVAVDI
EDALSRKRALNRELWELAAILAI
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtcaggtgaatcgtatcggtatgcttaccagtgggggtgacgcccctgggatg
aatgccgcgatcagggctgtggtgcgaaaatcaatttaccacggactcgaggttgtcggc
atcaagaggggtttcgacggcctgttgaagaaagagtttgtgaaactccagttgggttct
gtggccgatatcatacaccgggggggcaccatcctgcataccgcccggagcgaggaattc
aagacggaagagggacagcggaagggggtcaataatctccgggacggggggatcgacggc
cttgttgtcatcggtggtgatggttctttcaaaggcgccctggctctggctaagctcgga
gtgccggtgatcggggtgcctgcaaccatcgataacgacgtcggtggtaccgatctgacc
atcggcttcgacaccgccgtcaacaacgttgttgatgccatcaacaagatccgggacacc
gccacttcccacgaacggatctttatcattgaggtcatggggcgccatgccgggcacata
gcgctttatgccgggctctccgggggggcagaatccattttggtgccggaaatacccgtc
gatatcgatgaggtgatctttaaactgcagcgtggcatcaaccgggggaagcttcacagc
atcatcatcgttgctgaaggtgctgccagcggcctgacgatcggggaagagatcaaaaag
agaatgggccaggaaacccgggttaccattctcgggcacctgcagcgaggggggacaccg
acagctctagacaggatgctggcgagctgtatgggagcaaaagcggtggatctgctgctg
gaaggggagagcagaaaaatggtgggaattgttaacggacagctggtggcggtggatatt
gaggatgcgttatcccggaaacgggcgctgaatcgcgaactctgggaactggcggctatt
cttgccatctaa

DBGET integrated database retrieval system