KEGG   Thermacetogenium phaeum: Tph_c14230Help
Entry
Tph_c14230        CDS       T02276                                 

Gene name
sps1
Definition
(GenBank) serine/threonine-protein kinase Sps
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
tpz  Thermacetogenium phaeum
Brite
KEGG Orthology (KO) [BR:tpz00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tpz01001]
    Tph_c14230 (sps1)
Enzymes [BR:tpz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Tph_c14230 (sps1)
Protein kinases [BR:tpz01001]
 Serine/threonine kinases: Other
  Bacterial family
   Tph_c14230 (sps1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kinase-like MutS_IV Kdo RIO1 Pkinase_fungal PepSY_TM Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: AFV11632
UniProt: K4LHT6
LinkDB All DBs
Position
complement(1441408..1443237)
Genome map
AA seq 609 aa AA seqDB search
MKGKMLSNRYEIITKIGAGGMANVYQARCTVLNRIVTVKILREELAEDKDFVRRFQMEAQ
AVASLSHPNIVSIYDVGEEDGLPYLVMEYVEGTNLKEMIRRRGALPPSEAISIGVQVCAA
LEHAHSKGIIHRDIKPHNILVTPGGRVKVTDFGLARVLSIPSATVTQSGTVMGSVHYFSP
EQARGEEATPQSDIYSLGVVLYEAVSGKVPFQGDNPISIALKHLQEDPPGLRDENPAIPE
ELEEIILRAMSKSPAKRFQSAREMQKALSDGFISEDYEDYTEERTHYLAPVSKNQVGIER
RKRRLHPAAIGTLVLLFLIFLAGAVWGFFKWYFGETVAVPEVVGYSQAEAEQKLKAAGLE
AEVLTTYEEDSDEGIVVRQLPAAGMKVKKGRLVQIWVNKGKPLVWLPETTGTPEREAKIA
LESRGFQVRITREHSETVPEGYVIRQTPAGDRNYTEGSLITLVVSEGPVPRNIPVPKLIG
LNVEQAKATLEAVGLVLGEVREQPSEKYEQGVIISQSIEPGTLIRKGDPVDVVQSSGLIE
EPEVKTLDFRVHNTGEVRVVIKDAKGTRVAYQQIHEAGDRVKIPFEVYTPGEIEVYFQGQ
LVDKYKIDD
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggaaagatgctcagcaatagatacgaaataatcacaaaaatcggcgccggtggg
atggctaacgtctatcaagcccgctgtaccgtcctcaacaggattgtcaccgttaagatc
ctgcgcgaggagctggcagaggataaggatttcgtgcgccgctttcagatggaggcccaa
gcggtagcgagcctctcccatcccaatatcgttagtatttacgatgttggtgaagaggac
ggcttgccttatctggttatggaatatgttgaaggaaccaatcttaaagagatgatccgc
aggcgtggagcccttccaccatctgaggctatcagcattggtgttcaggtctgtgccgcc
ctcgagcatgctcacagcaaggggattattcacagagatatcaaaccccataatatatta
gtgacaccgggcggacgggtgaaagtgacagacttcggattggcgcgggtgctttcaatt
ccatccgccactgtaacccaatcgggcacggtgatgggctcggtccattacttttcccca
gaacaggcccggggggaagaggctactccccaatcggacatttactctttaggagtagtt
ctttacgaagcagtttcaggaaaagtaccctttcagggtgataatccgatttccatagct
ctcaagcacctccaggaggacccaccgggattgcgggatgaaaacccggcaatccccgaa
gagctggaggagattatcctccgggcaatgtcaaagtctcctgcgaaacggtttcagtca
gcacgggagatgcaaaaggctctatcggatggttttatctccgaagattatgaagattat
acagaagagcgcactcactatctggctccggtgagtaaaaatcaagtcggcatcgagcga
aggaaacgccgtctgcatcctgcagcaatagggactctggtcttattatttttaattttt
ctggcaggagctgtttggggcttcttcaagtggtattttggagagactgttgctgtcccc
gaagtagtaggatattcccaggcagaagccgaacagaaactgaaagccgccgggctggaa
gccgaggttcttacaacctatgaagaggacagcgatgaaggaatcgtggtacgacagcta
ccggcggcgggcatgaaagttaagaaaggccgtttggttcaaatttgggtaaataaggga
aaacccttagtttggctcccggaaaccacaggaacaccggaacgggaggcgaagattgcc
ctggagagcaggggtttccaggttagaataacgagggaacacagtgaaaccgttcccgag
gggtatgtaattagacagacccctgccggtgaccgcaactataccgaaggaagcttgata
acactggtggtaagcgaagggcctgtaccaagaaatattcccgtacccaagctaatcggg
ctgaatgtggagcaggctaaagccacgctggaggcagttgggcttgttttgggagaggtg
cgtgagcaaccgagcgaaaagtatgagcaaggggtaattataagccagagtatcgaaccg
gggacattgattcgaaaaggtgatcctgtcgatgtggttcagagcagcggcctcattgaa
gaaccggaagtaaaaaccctggatttcagagtacataataccggggaggtaagggtagtc
atcaaagatgctaaaggcacaagggtggcctaccagcaaatccacgaagcaggcgacagg
gtgaagatcccatttgaggtttatacaccaggtgagattgaggtctatttccagggtcag
ctggttgataaatataaaatcgatgattaa

DBGET integrated database retrieval system