KEGG   Thermacetogenium phaeum: Tph_c24730
Entry
Tph_c24730        CDS       T02276                                 

Definition
(GenBank) alanine dehydrogenase
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
tpz  Thermacetogenium phaeum
Pathway
tpz00300  Lysine biosynthesis
tpz01100  Metabolic pathways
tpz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tpz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Tph_c24730
Enzymes [BR:tpz01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     Tph_c24730
SSDB
Motif
Pfam: AlaDh_PNT_C AdoHcyase_NAD ELFV_dehydrog NAD_binding_7 Shikimate_DH
Other DBs
NCBI-ProteinID: AFV12647
UniProt: K4LKP9
LinkDB
Position
complement(2498836..2499681)
AA seq 281 aa
MTRLLQSDVERIAEEIGGYDEELLGKTGLTLRQIACRAAGISEKLLEQAAGRLPVAVIPV
TAGQGVIPFFTQAVQAVVRHLGFAAAIPGGSDVVGLAEAVAEGARIIFLADDRKFIALNI
LSGVMADNNEATGRGFVTALNALAGGLRGKEVLVLGAGPVGMAAISHLVVLGARPAVLDT
DPLKARFLELNGNLIVEHRLRPALAKYRYLVDATPRGNFIGVGDLHPEAFLAIPGMPPGL
TPEAFAAFRDRVIHDPLQIGVATMLAMAVGKPESGGGDAGV
NT seq 846 nt   +upstreamnt  +downstreamnt
atgacccgacttttgcagagcgatgtggagaggattgcagaagagatcggcggttatgac
gaggaattgcttggaaaaacggggctgaccttgcggcaaatagcctgcagggctgccggt
atttccgaaaaactcctggagcaggcagccggcaggctaccggttgccgttattcctgtt
accgccgggcagggggtgatccccttttttacccaggcggttcaggctgttgtccggcac
ctgggatttgccgcagcgatccccggcggctctgatgtcgtcgggctggcggaggcggtt
gccgaaggggcaagaattatcttcctggcggatgaccggaagttcattgctctcaatatc
ctctccggggttatggcggacaacaacgaggctaccggccgcggctttgtaaccgcctta
aacgccctggccggcggattaagagggaaggaagtccttgttctgggagccggccctgtg
ggaatggcggccatttcccatctggtggtgttgggagcccgcccggcggttctggacacc
gatcccctcaaggcccggtttttggagctgaacggcaatctcattgtggagcaccggctg
cgcccggccctggcgaaataccgctatcttgtcgacgccaccccccgggggaatttcatc
ggggttggcgatctgcaccccgaagcctttctggccataccggggatgcctccggggctc
accccagaggcctttgccgccttccgggacagggtgattcacgatcccctgcagatcggt
gtggctactatgttggccatggctgtggggaaaccggaatccggcggaggcgatgccggg
gtatag

DBGET integrated database retrieval system