KEGG   Truepera radiovictrix: Trad_1576Help
Entry
Trad_1576         CDS       T01254                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
tra  Truepera radiovictrix
Pathway
tra00473  D-Alanine metabolism
tra00550  Peptidoglycan biosynthesis
tra01100  Metabolic pathways
tra01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:tra00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Trad_1576
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Trad_1576
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Trad_1576
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tra01011]
    Trad_1576
Enzymes [BR:tra01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Trad_1576
Peptidoglycan biosynthesis and degradation proteins [BR:tra01011]
 Precursor biosynthesis
  Amino acid ligase
   Trad_1576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ADI14695
UniProt: D7CY56
LinkDB All DBs
Position
1693490..1694545
Genome map
AA seq 351 aa AA seqDB search
MCKLHTPSRSGRPRVLLLCGGRSDEHEVSLASARSVLAAAGSAFAVTPLVIGRDGRLLPE
AASRRVLCTPVPDTPPDALTATGALELSALEPGAFDVVFPLLHGPFGEDGSVQGLLKLLG
LPFVGSDVLGSAVGMDKGMMKAVFAAHGLPQVPYRLMTRSAWRRDPEGVLASLMDFGLPV
FVKPANLGSSVGISRADDPEGLREALETAARYDRRVLVERGLARARELEVGVLGNDAPRA
SVVGEIRYESLFYDYSTKYTEGEAEPLIPAPIPPELAARCQALALEAFRAVDAAGLARVD
FFLAGGELYLNEINTMPGFTRTSMFPKLWEASGVPYDALITQLIALALEAR
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaagttacacacacctagtcggagcggccgccccagggtgctgctcctctgcggc
ggccgctccgacgaacacgaggtgtcgctcgcctcggcgcgctccgtgttggcggcggcg
gggtcagcgttcgccgtgacgcccctggtgatcggccgcgacgggcggcttctgccggag
gcggcctcgcggcgcgttctctgcacaccggtaccggacaccccaccggacgcgctcacg
gcgaccggcgcgctcgagctgagcgccctcgagccgggcgcgttcgacgtcgtcttcccg
ctgctgcacggccctttcggcgaagacggcagcgtgcaggggctgctcaagctcctgggg
ctccccttcgtcggttcggacgttttggggagcgctgtggggatggacaaggggatgatg
aaggcggttttcgccgcgcacgggctgccgcaggtgccctaccggctcatgaccaggagc
gcgtggcggcgcgaccccgaaggggtcctggcgtcccttatggatttcggcctgcccgtg
tttgtcaaacccgctaacctcgggtcgtcggtcggcattagccgcgcggacgaccccgag
gggctgcgcgaggcgctcgagaccgccgcccgttacgaccgccgcgtgctcgtcgaacgg
ggcctcgcccgcgcgcgcgagctcgaggtcggcgtcttgggcaacgacgccccccgggcg
agcgtcgtcggcgagatccgctacgagagcctcttttacgactacagcaccaagtacacg
gagggcgaggcggagcccctgatccccgcccccatcccgcccgagctcgccgcgcgctgc
caagcgctcgcgcttgaagcgtttcgggcggtcgacgccgccggcctcgcccgcgtcgac
ttcttcctcgccggcggcgagctctacctcaacgagatcaacaccatgcccggctttacc
cgcacgagcatgttccccaaactgtgggaggcgagcggggtgccctacgacgcgctcatc
acgcagctcatcgcgctggcgctcgaagcgcgctag

DBGET integrated database retrieval system