KEGG   Truepera radiovictrix: Trad_2384Help
Entry
Trad_2384         CDS       T01254                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
tra  Truepera radiovictrix
Pathway
tra00620  Pyruvate metabolism
tra00680  Methane metabolism
tra01100  Metabolic pathways
tra01120  Microbial metabolism in diverse environments
tra01200  Carbon metabolism
Module
tra_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:tra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Trad_2384
  09102 Energy metabolism
   00680 Methane metabolism
    Trad_2384
Enzymes [BR:tra01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Trad_2384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ADI15493
UniProt: D7CT30
LinkDB All DBs
Position
complement(2609060..2611834)
Genome map
AA seq 924 aa AA seqDB search
MADLDTELRPPLQPPSGAPADADDAFRALRADVDYLGRTLGECLKELEGEAFFGLVERVR
ALTKALRAAPEDAARRRELGRDLGGLLKSLTTEDAERLLRAFSVYFQLINLAEEVHRVRV
NRLREAQATPEAPRRESVAAAVKALRDDGWSASEVRRFIEGLDIQPTLTAHPTEVKRYTV
RLKLERIASRLRARTELELSPQARRRLEGELAAEVASLWRTRELTSEKPSVTDEVKAALY
YFQRSLLSAVPQLMQDLEDALESLYGCARGEAPLPPVVRFRSWIGGDRDGNPFVTPEVTE
EAYALQSEVAFGQHLADLDGLVQRLSQWGGRTRISPELARELAALPADRRPRRFAGEPYR
LKLAVTYADLRRAHEALGRGDLPAGVAERYLEDLRTVEESLWAGGEGRVAEAFVRPVRYR
AAAFGVHLAALDLREHSSLHEAAVADLLRYAGVCDDYAAQDEAARVALLARELRSKRPLA
PEDAPLEEETGRALGFLRVLRRLRARYGPAAVGSYIVSMTAGVSDVLEPLLLAKEAGIPD
LDVTPLFETLADLRAAPRILQELFALPVYLEHVRRRGIQEVMIGYSDSNKDAGFLAANWA
LYEAQERVAAVCREVGVPLRLFHGRGTSIGRGGGPAGRAILAQPPGTLGGRMRLTEQGEA
LSERYTDPDLAHRHLEQLAHAFILSSARGARGDLPEPPVRYREAMTRAAEGARARYRALL
EADGFLDFYHTVTPIEEISRLNIGSRPARRKGERSLANLRAIPWVFSWTQCRANLPGWFG
LGTGLSSVDGALLREMYREWSFFRTILDFAQMSLAKADLGIFTAYLTLVPDALRERFWPL
IEREYRLSVERVTAATGQPLLASDPTLARGIELRNPYVDPISYVQVELLRRLRSLPEGAP
ERGGLEEAVMISLLGVATGLRNTG
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atggccgaccttgacaccgaactccgccccccgctgcaacccccaagcggcgcccccgcg
gacgccgacgacgcctttcgcgcccttcgcgccgacgtggactacttggggcgcaccctc
ggggagtgcctcaaagagctcgagggcgaggcctttttcgggctcgtcgaacgggtgcgg
gcgctcaccaaagcgctgcgcgccgcacccgaggacgcggcgcggcggcgcgagctgggg
cgcgacctcggcggcctgcttaaaagcctcaccaccgaggacgccgagcggctcctgcgc
gcctttagcgtctactttcagctgatcaacctcgccgaggaggtccaccgcgtgcgcgtc
aaccgcctccgcgaggcgcaggcgacccccgaggcgccgcgccgcgagtcggtggcggcg
gccgtcaaggcgctgcgcgacgacggctggtcggcctcggaggtgcggcgctttatcgag
gggctcgacatccaaccgaccctgacggcgcaccccaccgaggtcaaacgctacacggtg
cggctcaagctcgagcgcatcgcctcgcggctgcgcgcgcgcaccgagctcgagctctcg
ccgcaggcgcggcggcgtttggagggggagctcgccgccgaggtcgcgtcgctctggcgt
acccgcgagctcacctccgaaaagccctcggtgaccgacgaggtcaaggcggcgctctac
tactttcagcgctcgctgctgagcgccgtgccgcagcttatgcaagacctcgaggacgct
ctggagagcctctacggctgcgcgcgcggcgaggcgcccctgccgcccgtggtgcgcttt
cgttcgtggatcggcggcgaccgcgacggcaaccccttcgtcacccccgaggtcaccgag
gaggcctacgcgctccagtccgaggtggccttcgggcagcacctcgccgacctcgacggg
ttggtgcagcggctctcgcagtggggcgggcgcacccgcatcagccccgagctcgcgcgc
gagctcgcggcgctccccgccgacaggcggccgcgccgcttcgccggggagccctaccgc
ctcaaactggccgtgacgtacgccgacctgcgccgcgcccacgaggcgctcgggcgcggc
gacctccccgcgggcgtcgccgagcgctacctagaggacctgcggacggtcgaggagagc
ctctgggcggggggcgaggggcgcgttgccgaggcgttcgtccggcccgtgcgctaccgc
gccgccgcctttggggtgcacctcgccgcgctcgacctgcgcgagcactcgtcgctccac
gaggcggcggtcgccgacctcctgcgctacgccggggtctgcgacgactacgcggcgcaa
gacgaggcggcgcgcgtggcgctgctcgcgcgcgagctccgctccaaacgcccgctcgcc
cccgaagacgcccccctcgaggaggaaacgggccgcgcgctcggctttttgcgcgtcctg
cgccgtctgcgcgcccgttacggtccggcggcggtgggttcgtacatcgtctcgatgacg
gccggggtgtcggatgttttggagcccttgctgctcgccaaagaggcgggcatccccgac
ctcgacgtcaccccccttttcgagacgctcgccgatctgcgcgccgcgccccgcatcctg
caggagctcttcgccctgcccgtctacctcgagcacgtccggaggcgcggcatccaagag
gtgatgatcggctactccgactcgaacaaggacgcgggctttctggcggccaactgggcg
ctctacgaggcccaagagcgcgtcgcggcggtctgccgcgaggtcggggtgcccctgcgg
ctctttcacggccggggcacctcgatcggccgcgggggggggccggcggggcgcgccatc
ttggcgcagccgccggggacgctgggggggcggatgcggctcaccgaacagggcgaagcg
ctctcggagcgctacaccgaccccgacctggcccaccggcacctcgagcagctcgcccac
gcctttatcctctcgtcggcgcgcggcgcgcgcggcgacctgcccgagccgccggtgcgt
taccgcgaggccatgacccgcgcggccgagggggcgcgcgcccgctaccgcgccctgctc
gaagcggacggctttctggacttttaccacacggtcacccccattgaggagattagccgc
ctcaacatcgggtcgcgccccgcgcggcgcaagggggagcgctcgctcgccaatttgcgg
gcgatcccgtgggtgttctcgtggacgcagtgccgcgccaacttgccggggtggttcggg
ctcggcacggggctctcgagcgtcgacggggcgcttttgcgggagatgtaccgggagtgg
tcgttttttcgcaccatcttggactttgcccagatgagtctcgcaaaggccgacctgggg
atctttaccgcctacttaacgctcgtcccggacgcgctgcgcgaacgcttttggccgctc
atcgagcgcgagtaccggctctcggtagagcgggtgacggcggcgacggggcagcccctg
ttggcgagcgacccgacgctcgcgcgcggcatcgagctgcgcaacccctacgtcgacccc
atctcctacgtgcaggtcgagctgctgcggcgcctgcgctcgcttcccgagggggcgccg
gagcgtggtggcctcgaggaggcggtgatgatcagcctcctcggggtggcgacggggttg
cgcaacacgggctaa

DBGET integrated database retrieval system