KEGG   Truepera radiovictrix: Trad_2895Help
Entry
Trad_2895         CDS       T01254                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
tra  Truepera radiovictrix
Pathway
tra00040  Pentose and glucuronate interconversions
tra00051  Fructose and mannose metabolism
tra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Trad_2895
   00051 Fructose and mannose metabolism
    Trad_2895
Enzymes [BR:tra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     Trad_2895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ADI15993
UniProt: D7CVT2
LinkDB All DBs
Position
3151447..3152475
Genome map
AA seq 342 aa AA seqDB search
MRAAVLHRARDLRLEEVPTPAYGSDDVLVRIKSVGICGSDVHYWRTGHIGDFVVKAPMIL
GHEVAGVVAAVGANVSALKVGDRVALEPGVPCRRCEWCKTGRYNLCPDVRFFATPPVDGA
LAEYAVSPADFAYKLPDALSLDAAALIEPLSVGIHACRRGGLTAGQSVFIAGAGPIGLTS
LVAARAAGATEVVISDVRPHRLEVARKMGASHTFDAREDALAHVMEVTSGRGVDLAIECA
GAEAALVSCLKAAKRGGTVVVVGLGDAADYTLPMVELAVKELDVKGIFRYVYTYPAAINL
LASGRADVEAMITHRFPLDDLLTAFAYAEEGTDGAVKVMVEV
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagccgtcttacatagggcccgggacctgcgcctcgaagaggtgcccacccct
gcctacggctccgacgacgtgttggtgaggatcaagtcggtcggtatctgcggctccgac
gtccactactggcgcacgggacacatcggtgacttcgtggtgaaagcgcccatgatcctc
ggccacgaggtcgcgggcgtcgtcgcggcggtcggcgcgaacgtcagcgcgctcaaggtg
ggcgaccgggtggccttggagcccggcgtcccctgccgccgctgcgaatggtgcaagacg
ggccgctacaacctctgccccgacgtgcgctttttcgccaccccaccggtcgacggggcg
ctcgccgagtacgccgtctcccccgctgacttcgcctacaagctgcccgacgcgctcagc
ctcgacgccgcagcgcttatcgaaccgctctcggtcggtatccacgcctgccggcgcggg
gggctcacggccgggcagagcgtctttatcgcgggcgccggccccatcgggctgacctcg
ctcgtggccgccagggcggcgggggcgacggaggttgtgatcagcgacgtgcggccgcac
cggctggaggtcgcccgcaagatgggggctagccacaccttcgacgctcgcgaagacgcc
cttgcgcacgtcatggaggtcacctcggggcgcggcgtggacctcgccatcgagtgcgcg
ggcgccgaagcggccctcgtcagctgcctaaaagcggccaagcgcggcggtacggtcgtc
gtggtcggtttgggcgacgccgccgactacaccctgccgatggtcgagctcgcggtcaag
gagctcgacgtcaaggggatcttccgctacgtctacacctaccccgcggcgatcaacctg
ctcgcctcgggcagggcggacgtcgaggcgatgatcacccaccgcttccctttggatgac
ctcctcacggccttcgcgtacgccgaagagggcaccgacggggcggtcaaggtgatggtc
gaggtctag

DBGET integrated database retrieval system