KEGG   Truepera radiovictrix: Trad_2990Help
Entry
Trad_2990         CDS       T01254                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
tra  Truepera radiovictrix
Pathway
tra00020  Citrate cycle (TCA cycle)
tra00270  Cysteine and methionine metabolism
tra00620  Pyruvate metabolism
tra00630  Glyoxylate and dicarboxylate metabolism
tra00680  Methane metabolism
tra01100  Metabolic pathways
tra01110  Biosynthesis of secondary metabolites
tra01120  Microbial metabolism in diverse environments
tra01130  Biosynthesis of antibiotics
tra01200  Carbon metabolism
Module
tra_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tra_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tra_M00012  Glyoxylate cycle
tra_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:tra00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Trad_2990
   00620 Pyruvate metabolism
    Trad_2990
   00630 Glyoxylate and dicarboxylate metabolism
    Trad_2990
  Energy metabolism
   00680 Methane metabolism
    Trad_2990
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Trad_2990
Enzymes [BR:tra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     Trad_2990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N Kelch_4
Motif
Other DBs
NCBI-ProteinID: ADI16084
UniProt: D7CWD4
LinkDB All DBs
Position
complement(3254567..3255547)
Genome map
AA seq 326 aa AA seqDB search
MKQPVRVAVTGAAGQIGYALLFRIAAGDMLGPDQPVILQLLEIPPAMKALEGVVMELHDG
AFPLLHGVTTTDDAKVAFEGADYALLVGSRPRGPGMERRDLLEANGHIFTEQGRALNEVA
SREVKVLVVGNPANTNALIAMRSAPDLRPEQFTAMTRLDHNRALSQLAQKAGVAVAEVRR
MTIWGNHSSTQVPDLTHATVGGRPATEVVDDAWVRDTFMPTVQKRGAAIIEARGASSAAS
AASAAIDHMRDWVLGTPEGDWTSMAIPSTGAYGVAEGLIYSFPVTTAGGTIRVVEGLEVG
DFIRQKMRASEAELIEEREAVAHLLG
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcaaccggtgcgggtagcggtgacgggagcagctgggcagatcgggtacgcgctt
ctttttcggatcgctgcgggtgacatgttggggccggatcagccggtcatcttacagctt
ttggaaatcccccccgcgatgaaagcgcttgaaggggtggtgatggagctgcacgacggg
gcatttccgctgctccacggtgtaacgaccacggatgacgccaaggtcgccttcgagggg
gccgactacgcgctgctcgtcggttcacgcccccgcggccccgggatggagcgccgtgac
ctgctcgaggcgaacggccacatctttaccgagcaggggagagcgctgaacgaggtggcc
agccgcgaggtcaaggtgctcgtcgtcggcaacccggccaacacaaacgcgctcatcgcc
atgcgcagcgcccccgatctgcgccccgagcagtttacggcgatgacccgcctcgaccac
aaccgcgcgctcagccagctcgctcagaaggcgggggtggcggtcgccgaggtgcgccgg
atgaccatctggggcaaccactcgagcacccaggtgcccgacctgacgcacgccacggtc
ggggggagaccagcgaccgaggtggtcgatgacgcgtgggtccgcgacacctttatgccg
accgtgcagaagcggggcgcggcgatcatcgaagcgcggggcgcctcgagcgccgcctcg
gccgcctcggcggcgatcgaccacatgcgcgactgggtccttggaacgccggaaggcgac
tggacgagtatggcgatccccagcacgggtgcctacggggtcgccgaggggctcatctat
tcgtttccggtgactacggccggtggtacgatccgcgtcgtcgagggcttagaggtgggc
gactttatccgtcagaagatgcgggcgagcgaggccgagctgatcgaggagcgtgaggcg
gtagcccatctgctagggtaa

DBGET integrated database retrieval system