Tardiphaga robiniae: HB776_05485 Help Entry HB776_05485       CDS       T06738                                  Name (GenBank) hypothetical protein   KO K19222   1,4-dihydroxy-2-naphthoyl-CoA hydrolase [EC:3.1.2.28] Organism trb  Tardiphaga robiniae Pathway trb00130   Ubiquinone and other terpenoid-quinone biosynthesis trb01100   Metabolic pathways trb01110   Biosynthesis of secondary metabolites trb01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:trb00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00130 Ubiquinone and other terpenoid-quinone biosynthesis     HB776_05485 Enzymes [BR:trb01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.2  Thioester hydrolases     3.1.2.28  1,4-dihydroxy-2-naphthoyl-CoA hydrolase      HB776_05485 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  QND70747 UniProt:  A0A7G6TVG5 LinkDB All DBs Position complement(1203307..1203546) Genome browser AA seq 79 aa AA seqDB search MIYLYVVTGCRTLEDGATHVQSGFGTVMATSRDEALGKAIQIWHNDHPSHKMVCFNATAR PDLRIVASKKARRPHLMRF NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgatctacctctatgtcgtcacgggctgtcgcacgttggaggacggcgcgacccacgta caaagcggcttcggcacggtgatggcgaccagccgcgacgaagcgctcggcaaggccatt caaatttggcacaacgaccacccaagccacaaaatggtttgcttcaacgcaaccgcgcgg cccgatctgcgtatcgtggcctccaaaaaagctcggcgtccgcatttgatgcgcttctga

DBGET integrated database retrieval system